1. Recombinant Proteins
  2. Others
  3. TIM-14 Protein, S.cerevisiae

The TIM-14 protein is an important component of the PAM complex and is required for the transport of transit peptide-containing proteins from the inner membrane to the mitochondrial matrix using ATP. TIM-14 Protein, S.cerevisiae is the recombinant TIM-14 protein, expressed by E. coli , with tag free. The total length of TIM-14 Protein, S.cerevisiae is 70 a.a., with molecular weight of ~9.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The TIM-14 protein is an important component of the PAM complex and is required for the transport of transit peptide-containing proteins from the inner membrane to the mitochondrial matrix using ATP. TIM-14 Protein, S.cerevisiae is the recombinant TIM-14 protein, expressed by E. coli , with tag free. The total length of TIM-14 Protein, S.cerevisiae is 70 a.a., with molecular weight of ~9.0 kDa.

Background

TIM-14 stands as an indispensable constituent of the PAM complex, a pivotal assembly instrumental in the ATP-dependent translocation of transit peptide-containing proteins from the inner mitochondrial membrane into the mitochondrial matrix. Within this intricate molecular machinery, TIM-14 assumes a critical role in stimulating the activity of mtHSP70 (SSC1). It engages in a dynamic existence, forming homodimers and heterodimers with PAM16/TIM16. While homodimerization might not hold significance in vivo, the formation of heterodimers proves to be essential for the nuanced regulation of mtHSP70 activity. As an integral part of the larger PAM complex, TIM-14 collaborates seamlessly with mtHsp70, MGE1, TIM44, PAM16, PAM17, and PAM18/TIM14, collectively contributing to the orchestration of mitochondrial protein translocation. Additionally, TIM-14 establishes direct interactions with mtHsp70, reinforcing its role in the intricate network of molecular associations involved in ensuring the efficiency and precision of mitochondrial protein translocation. Furthermore, its direct interaction with the TIM17 subunit of the TIM23 complex adds another layer of complexity to its involvement in mitochondrial protein transport processes.

Species

Others

Source

E. coli

Tag

Tag Free

Accession

Q07914 (F99-K168)

Gene ID

850694  [NCBI]

Molecular Construction
N-term
TIM-14 (F99-K168)
Accession # Q07914
C-term
Synonyms
Mitochondrial import inner membrane translocase subunit TIM14; Presequencetranslocated associated motor subunit PAM18; PAM18; TIM14
AA Sequence

FLKGGFDPKMNSKEALQILNLTENTLTKKKLKEVHRKIMLANHPDKGGSPFLATKINEAKDFLEKRGISK

Molecular Weight

Approximately 9.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

TIM-14 Protein, S.cerevisiae Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TIM-14 Protein, S.cerevisiae
Cat. No.:
HY-P71366
Quantity:
MCE Japan Authorized Agent: