1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Protease Inhibitors
  4. Tissue Inhibitor of Metalloproteinase (TIMPs)
  5. Tissue Inhibitor of Metalloproteinase 4 (TIMP-4)
  6. TIMP-4 Protein, Human (HEK293, His)

TIMP-4, a member of the tissue inhibitor of metalloproteinases family, forms complexes with metalloproteinases, including collagenases, and exerts irreversible inactivation by binding to their catalytic zinc cofactor. Its inhibitory effect is recognized on a range of metalloproteases, particularly MMP-1, MMP-2, MMP-3, MMP-7 and MMP-9. TIMP-4 Protein, Human (HEK293, His) is the recombinant human-derived TIMP-4 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of TIMP-4 Protein, Human (HEK293, His) is 195 a.a., with molecular weight of ~24.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TIMP-4, a member of the tissue inhibitor of metalloproteinases family, forms complexes with metalloproteinases, including collagenases, and exerts irreversible inactivation by binding to their catalytic zinc cofactor. Its inhibitory effect is recognized on a range of metalloproteases, particularly MMP-1, MMP-2, MMP-3, MMP-7 and MMP-9. TIMP-4 Protein, Human (HEK293, His) is the recombinant human-derived TIMP-4 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of TIMP-4 Protein, Human (HEK293, His) is 195 a.a., with molecular weight of ~24.0 kDa.

Background

Tissue inhibitor of metalloproteinases-4 (TIMP-4) is a protein that forms complexes with metalloproteinases, including collagenases, leading to their irreversible inactivation through binding to their catalytic zinc cofactor. TIMP-4 exhibits broad-spectrum inhibitory activity, known to act on various matrix metalloproteinases (MMPs) such as MMP-1, MMP-2, MMP-3, MMP-7, and MMP-9. By regulating the activity of these MMPs, TIMP-4 plays a crucial role in modulating extracellular matrix remodeling, thereby influencing processes like tissue development, maintenance, and repair. The ability of TIMP-4 to interact with and inhibit multiple MMPs highlights its importance in maintaining the balance of proteolytic activities and underscores its potential significance in various physiological and pathological contexts. (

Biological Activity

Measured by its ability to inhibit human MMP-2(HY-P73296) cleavage of a fluorogenic peptide substrate 10 µM Mca-PLGL-Dpa-AR-NH2(HY-131498) that incubate at room temperature in kinetic mode for 5 minutes . The IC50 value is approximately 1.013 nM.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q99727 (C30-P224)

Gene ID
Molecular Construction
N-term
TIMP-4 (C30-P224)
Accession # Q99727
6*His
C-term
Synonyms
Metalloproteinase inhibitor 4; TIMP-4; Tissue inhibitor of metalloproteinases 4; TIMP4
AA Sequence

CSCAPAHPQQHICHSALVIRAKISSEKVVPASADPADTEKMLRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHLNCGCQITTCYTVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGTCSWYRGHLPLRKEFVDIVQP

Molecular Weight

Approximately 24.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TIMP-4 Protein, Human (HEK293, His)
Cat. No.:
HY-P71368
Quantity:
MCE Japan Authorized Agent: