Tissue Factor Protein, Cynomolgus (HEK293, His)

F3 Protein, a cell surface receptor, plays a significant role in regulating blood coagulation and promoting cell adhesion. Dysregulation of F3 Protein has been associated with various disorders, including thrombosis and cancer. Targeting F3 Protein may offer potential therapeutic interventions in these conditions by inhibiting blood clot formation and preventing tumor cell adhesion and metastasis. Tissue Factor Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Tissue Factor protein, expressed by HEK293 , with C-His labeled tag.

F3 Protein, also known as tissue factor (TF), serves as the initiator of blood coagulation by forming a complex with circulating factor VII or VIIa. This complex, [TF:VIIa], triggers the activation of factors IX or X through specific limited proteolysis. In normal hemostasis, TF plays a crucial role in initiating the assembly and propagation of the coagulation protease cascade on the cell surface. Furthermore, F3 Protein interacts with HSPE, and this interaction is hindered by heparin. The interaction promotes the generation of activated factor X and activates coagulation in the presence of activated factor VII.

Measured by its ability to activate Coagulation Factor VII in cleaving a fluorogenic peptide substrate Boc-VPR-AMC. The AC50 is 6.991 μg/mL, as measured under the described conditions, corresponding to a specific activity is 143.041 units/mg.

Cynomolgus

HEK293

C-His

A0A2K5VX02 (S33-E252)

102131431

SGTTNTVAAYNLTWKSTNFKTILEWEPKPINQVYTVQISTKSGDWKSKCFYTADTECDLTDEIVKDVKQTYLARVFSYPAGHVESTGSTEEPPYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVQDEWTLVRRNDTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRRTANRKSTDSPVECMGHEKGESRE

approximately 34-50 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized a 0.22 μm filtered solution of 50 mM Tris, 150 mM NaCl, pH 7.5.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.