1. Recombinant Proteins
  2. Others
  3. TMEM173 Protein, Human (Sumo-His)

TMEM173 Protein, Human (Sumo-His)

Cat. No.: HY-P70700
SDS COA Handling Instructions

The TMEM173 protein acts as a promoter of innate immune signaling, acting as a sensor of bacterial and viral cytoplasmic DNA, ultimately promoting the production of type I interferons (IFN-α and IFN-β). This innate immune response is triggered in response to the delivery of non-CpG double-stranded DNA from viruses and bacteria into the cytoplasm. TMEM173 Protein, Human (Sumo-His) is the recombinant human-derived TMEM173 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag. The total length of TMEM173 Protein, Human (Sumo-His) is 187 a.a., with molecular weight of 35-38 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg $120 In-stock
50 μg $360 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The TMEM173 protein acts as a promoter of innate immune signaling, acting as a sensor of bacterial and viral cytoplasmic DNA, ultimately promoting the production of type I interferons (IFN-α and IFN-β). This innate immune response is triggered in response to the delivery of non-CpG double-stranded DNA from viruses and bacteria into the cytoplasm. TMEM173 Protein, Human (Sumo-His) is the recombinant human-derived TMEM173 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag. The total length of TMEM173 Protein, Human (Sumo-His) is 187 a.a., with molecular weight of 35-38 kDa.

Background

The TMEM173 protein acts as a facilitator of innate immune signaling, functioning as a sensor for cytosolic DNA from bacteria and viruses, ultimately promoting the production of type I interferon (IFN-alpha and IFN-beta). This innate immune response is triggered in response to non-CpG double-stranded DNA from viruses and bacteria delivered to the cytoplasm. TMEM173 recognizes and binds cyclic dinucleotides, specifically cyclic di-GMP (c-di-GMP), a second messenger produced by bacteria, and cyclic GMP-AMP (cGAMP), a messenger produced by CGAS in response to DNA virus in the cytosol. Upon binding to c-di-GMP or cGAMP, TMEM173 oligomerizes, translocates from the endoplasmic reticulum, and is phosphorylated by TBK1, leading to the recruitment and activation of the transcription factor IRF3. This induces the expression of type I interferon, establishing a potent anti-viral state. Additionally, TMEM173 plays a direct role in autophagy, with cGAMP-binding initiating ERGIC formation, which serves as the membrane source for autophagosome formation, targeting cytosolic DNA or DNA viruses for lysosomal degradation. The multifaceted activities of TMEM173 highlight its central role in orchestrating innate immune responses and autophagic processes, contributing to the cell's defense against viral and bacterial threats.

Species

Human

Source

E. coli

Tag

N-SUMO;N-6*His

Accession

Q86WV6 (V155-V341)

Gene ID
Molecular Construction
N-term
SUMO-6*His
TMEM173 (V155-V341)
Accession # Q86WV6
C-term
Synonyms
Stimulator of interferon genes protein; TMEM173; Mediator of IRF3 activation; sting;
AA Sequence

VAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEV

Molecular Weight

35-38 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM HEPES, 100 mM NaCl, 10% Glycerol, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

TMEM173 Protein, Human (Sumo-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TMEM173 Protein, Human (Sumo-His)
Cat. No.:
HY-P70700
Quantity:
MCE Japan Authorized Agent: