TMIGD1 Protein, Human (HEK293, His)

TMIGD1 is a potential regulator that affects multiple cellular processes, including adhesion, migration, proliferation, and morphology. Its protective effect against oxidative damage in renal epithelial cells promotes cell survival. TMIGD1 Protein, Human (HEK293, His) is the recombinant human-derived TMIGD1 protein, expressed by HEK293 , with C-His labeled tag. The total length of TMIGD1 Protein, Human (HEK293, His) is 191 a.a., with molecular weight (glycosylation form) of ~37-55 kDa.

The TMIGD1 protein emerges as a potential regulator influencing diverse cellular processes, including cell-cell adhesion, migration, proliferation, and morphology. Additionally, TMIGD1 exhibits a protective role in renal epithelial cells by safeguarding them against oxidative cell injury, thereby promoting cell survival. The formation of homodimers by TMIGD1 indicates its ability to interact with itself, possibly playing a role in the modulation of its functional activities. The multifaceted nature of TMIGD1 in cellular regulation underscores its potential significance in maintaining cellular homeostasis and responding to environmental challenges. Further exploration is essential to uncover the specific molecular mechanisms through which TMIGD1 exerts its regulatory effects on cell behavior and survival.

Human

HEK293

C-His

Q6UXZ0-1/NP_996663.1 (V30-P220)

388364  [NCBI]

VLTVNGKTENYILDTTPGSQASLICAVQNHTREEELLWYREEGRVDLKSGNKINSSSVCVSSISENDNGISFTCRLGRDQSVSVSVVLNVTFPPLLSGNDFQTVEEGSNVKLVCNVKANPQAQMMWYKNSSLLDLEKSRHQIQQTSESFQLSITKVEKPDNGTYSCIAKSSLKTESLDFHLIVKDKTVGVP

Approximately 37-55 kDa due to glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.