1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Isomerases (EC 5)
  4. TMX2 Protein, Human (His)

The TMX2 protein is an endoplasmic reticulum- and mitochondria-associated regulator that controls cellular redox status and affects post-translational modifications, protein folding, and mitochondrial activity. TMX2 Protein, Human (His) is the recombinant human-derived TMX2 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The TMX2 protein is an endoplasmic reticulum- and mitochondria-associated regulator that controls cellular redox status and affects post-translational modifications, protein folding, and mitochondrial activity. TMX2 Protein, Human (His) is the recombinant human-derived TMX2 protein, expressed by E. coli , with N-6*His labeled tag.

Background

TMX2 Protein, an endoplasmic reticulum and mitochondria-associated protein, likely serves as a crucial regulator of cellular redox state, thereby influencing protein post-translational modification, protein folding, and mitochondrial activity. This multifunctional role underscores its impact on fundamental cellular processes. TMX2's involvement in oxidative conditions enhances its homodimerization, indicating a dynamic response to the cellular redox environment. Structurally, TMX2 exists as a monomer, with the capacity to form disulfide-linked homodimers. Furthermore, it interacts with CANX and ATP2A2, suggesting potential associations with key players in cellular processes. Notably, TMX2's regulatory influence extends to neuronal proliferation, migration, and organization in the developing brain, implicating its significance in neurodevelopmental processes. The versatility of TMX2 in redox regulation and its interactions with critical cellular components emphasize its intricate role in cellular homeostasis and developmental pathways.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q9Y320-1 (M125-K296)

Gene ID
Molecular Construction
N-term
6*His
TMX2 (M125-K296)
Accession # Q9Y320-1
C-term
Synonyms
Thioredoxin-related transmembrane protein 2; Cell proliferation-inducing gene 26 protein; Thioredoxin domain-containing protein 14; TMX2
AA Sequence

MTCKPPLYMGPEYIKYFNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNCTGLNFGKVDVGRYTDVSTRYKVSTSPLTKQLPTLILFQGGKEAMRRPQIDKKGRAVSWTFSEENVIREFNLNELYQRAKKLSKAGDNIPEEQPVASTPTTVSDGENKKDK

Molecular Weight

Approximately 23.0 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

TMX2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TMX2 Protein, Human (His)
Cat. No.:
HY-P71371
Quantity:
MCE Japan Authorized Agent: