TNF-alpha/TNFSF2 Protein, Bovine (His)

TNF-α/TNFSF2 protein is secreted by macrophages, binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, induces tumor cell death and acts as a pyrogen. It is associated with cachexia, stimulates cell proliferation and differentiation, and induces insulin resistance in adipocytes. TNF-alpha/TNFSF2 Protein, Bovine (His) is the recombinant bovine-derived TNF-alpha/TNFSF2 protein, expressed by E. coli , with N-6*His labeled tag.

TNF-alpha/TNFSF2 protein, a cytokine, binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. Primarily secreted by macrophages, it demonstrates the capacity to induce cell death in specific tumor cell lines and acts as a potent pyrogen, causing fever either through direct action or by stimulating interleukin-1 secretion. Additionally, TNF-alpha is implicated in the induction of cachexia, and under certain conditions, it can promote cell proliferation and induce cell differentiation. Its impact extends to inducing insulin resistance in adipocytes by inhibiting insulin-induced IRS1 tyrosine phosphorylation and glucose uptake, leading to GKAP42 protein degradation and TNF-induced insulin resistance. Playing a role in angiogenesis, TNF-alpha collaboratively induces VEGF production with IL1B and IL6. Furthermore, it facilitates osteoclastogenesis, contributing to bone resorption. Notably, the TNF intracellular domain (ICD) form elicits IL12 production in dendritic cells, showcasing its diverse involvement across various physiological processes.

Bovine

E. coli

N-6*His

Q06599-1 (L78-L234)

280943  [NCBI]

LRSSSQASSNKPVAHVVADINSPGQLRWWDSYANALMANGVKLEDNQLVVPADGLYLIYSQVLFRGQGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETPEWAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPDYLDYAESGQVYFGIIAL

21.4 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.