TNF-alpha/TNFSF2 Protein, Pig (N-His)

TNF-α/TNFSF2 protein is a cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and has multiple biological functions. It has the ability to induce cell death in specific tumor cell lines, serves as a potent pyrogen, can cause fever through direct action or stimulation of interleukin-1 secretion, and is involved in the induction of cachexia. TNF-alpha/TNFSF2 Protein, Pig (N-His) is the recombinant Pig-derived TNF-alpha/TNFSF2 protein, expressed by E. coli , with N-6*His labeled tag.

TNF-alpha/TNFSF2 protein, a cytokine, binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, predominantly secreted by macrophages and exhibiting diverse biological functions. It possesses the capability to induce cell death in specific tumor cell lines, serving as a potent pyrogen that can cause fever through direct action or by stimulating interleukin-1 secretion, and is implicated in the induction of cachexia. Under certain conditions, TNF-alpha/TNFSF2 can play a role in both stimulating cell proliferation and inducing cell differentiation. It also contributes to insulin resistance in adipocytes by inhibiting insulin-induced IRS1 tyrosine phosphorylation and glucose uptake, with additional effects on GKAP42 protein degradation. Furthermore, TNF-alpha/TNFSF2 participates in angiogenesis by synergistically inducing VEGF production with IL1B and IL6, and promotes osteoclastogenesis, thereby mediating bone resorption. The intracellular domain (ICD) form of TNF-alpha induces IL12 production in dendritic cells, further highlighting its multifaceted impact on diverse cellular processes.

Measured in a cytotoxicity assay using TNF-susceptible PK-15 porcine kidney epithelial cells in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 0.06386 ng/mL, corresponding to a specific activity is 1.57×10^7 units/mg.

• 
  Measured in a cytotoxicity assay using TNF-susceptible PK-15 porcine kidney epithelial cells in the presence of the metabolic inhibitor actinomycin D. The ED₅₀ for this effect is 0.06386 ng/mL，corresponding to a specific activity is 1.57×10⁷ units/mg.

Pig

E. coli

N-6*His

P23563 (R78-L232)

397086

RSSSQTSDKPVAHVVANVKAEGQLQWQSGYANALLANGVKLKDNQLVVPTDGLYLIYSQVLFRGQGCPSTNVFLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKDDRLSAEINLPDYLDFAESGQVYFGIIAL

approximately 20 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.