TNF-beta/TNFSF1 Protein, Human (HEK293, His-Avi)

TNF-β protein acts as a homotrimeric cytokine that binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR, and TNFRSF14/HVEM. TNF-beta/TNFSF1 Protein, Human (HEK293, His-Avi) is the recombinant human-derived TNF-beta/TNFSF1 protein, expressed by HEK293 , with N-Avi, N-6*His labeled tag. The total length of TNF-beta/TNFSF1 Protein, Human (HEK293, His-Avi) is 171 a.a., with molecular weight of 22.7 kDa.

TNF-beta Protein, in its homotrimeric configuration, exhibits binding capabilities to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR, and TNFRSF14/HVEM, as demonstrated by various studies. Additionally, in its heterotrimeric association with LTB, it forms interactions with TNFRSF3/LTBR, underscoring its diverse receptor engagement. This cytokine, primarily produced by lymphocytes, showcases cytotoxic effects against a broad array of tumor cells both in vitro and in vivo. Structurally, TNF-beta exists as both homotrimers and heterotrimers, the latter comprising either two LTB and one LTA subunits or, to a lesser extent, two LTA and one LTB subunits. Furthermore, TNF-beta engages in interactions with TNFRSF14, emphasizing its pivotal role in mediating intricate immunological responses.

Human

HEK293

N-Avi;N-6*His

P01374 (L35-L205)

4049  [NCBI]

LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL

22.7 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.