1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens
  3. TNF Superfamily Epithelial cell CD Proteins Endothelial cell CD Proteins
  4. TNF Receptor Superfamily TNF-RI/CD120a
  5. TNF-RI/CD120a
  6. TNFR-1/CD120a Protein, Human (HEK293, Fc)

The TNFR-1/CD120a protein is a receptor for TNFSF2/TNF-α and TNFSF1/lymphotoxin-α, and initiates caspase-8-mediated apoptosis upon TNF binding. It induces non-cytocidal TNF action, activates acid sphingomyelinase and establishes an antiviral state. TNFR-1/CD120a Protein, Human (HEK293, Fc) is the recombinant human-derived TNFR-1/CD120a protein, expressed by HEK293 , with C-hFc labeled tag. The total length of TNFR-1/CD120a Protein, Human (HEK293, Fc) is 182 a.a., with molecular weight of 55-70 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The TNFR-1/CD120a protein is a receptor for TNFSF2/TNF-α and TNFSF1/lymphotoxin-α, and initiates caspase-8-mediated apoptosis upon TNF binding. It induces non-cytocidal TNF action, activates acid sphingomyelinase and establishes an antiviral state. TNFR-1/CD120a Protein, Human (HEK293, Fc) is the recombinant human-derived TNFR-1/CD120a protein, expressed by HEK293 , with C-hFc labeled tag. The total length of TNFR-1/CD120a Protein, Human (HEK293, Fc) is 182 a.a., with molecular weight of 55-70 kDa.

Background

The TNFR-1/CD120a protein acts as a receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. Upon TNF binding, the adapter molecule FADD recruits caspase-8 to the activated receptor, initiating the formation of the death-inducing signaling complex (DISC). This complex leads to caspase-8 proteolytic activation, triggering subsequent caspase-mediated apoptosis. TNFR-1/CD120a is involved in the induction of non-cytocidal TNF effects, including the establishment of an anti-viral state and activation of acid sphingomyelinase. Homotrimerization of TNFR-1/CD120a upon TNF binding provides a molecular interface for specific interactions with the death domain of TRADD, recruiting various TRADD-interacting proteins such as TRAFS, RIPK1, and possibly FADD. This complex activates distinct signaling cascades, including apoptosis and NF-kappa-B signaling. Additionally, TNFR-1/CD120a interacts with a variety of proteins, including BAG4, BABAM2, FEM1B, GRB2, SQSTM1, TRPC4AP, NOL3, SH3RF2, PGLYRP1, and MADD, playing a role in modulating the TNF-signaling pathway and apoptosis induction.

Biological Activity

Measured by its ability to inhibit the TNF-alpha mediated cytotoxicity inthe L-929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D.The ED50 for this effect is ≤0.1558 μg/mLin the presence of 0.25 ng/mL of recombinant humanTNF-alpha, corresponding to a specific activity is ≥6.418×103 units/mg.

  • Measured by its ability to inhibit the TNF-alpha mediated cytotoxicity inthe L-929 mouse fibroblast cells in the presence of the metabolic inhibitoractinomycin D.The ED50 for this effect is 0.1558 μg/mLin the presence of 0.25 ng/mL of recombinant humanTNF-alpha, corresponding to a specific activity is 6.418×103 units/mg.
Species

Human

Source

HEK293

Tag

C-hFc

Accession

P19438 (L30-T211)

Gene ID
Molecular Construction
N-term
TNFR-1 (L30-T211)
Accession # P19438
hFc
C-term
Synonyms
Tumor necrosis factor receptor superfamily member 1A; CD120a; TNF-R1; TNFRSF1A
AA Sequence

LVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT

Molecular Weight

55-70kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<0.1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TNFR-1/CD120a Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TNFR-1/CD120a Protein, Human (HEK293, Fc)
Cat. No.:
HY-P700264
Quantity:
MCE Japan Authorized Agent: