1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens
  3. TNF Superfamily Macrophage CD Proteins
  4. TNF Receptor Superfamily RANK/CD265
  5. RANK/CD265
  6. RANK/TNFRSF11A Protein, Human (His)

RANK (TNFRSF11A) is a receptor activator of nuclear factor κB (NF-κB), which is involved in bone metabolism and immune system function. RANK is mainly expressed by osteoblasts/stromal cells, and is associated with the formation of giant cell tumor of bone (GCTBs) . RANK combined with RANKL ligand activated the RANKL/RANK/ OPG system to regulate bone resorption . RANKL/RANK is also a regulator of dendritic cell (DC)-T cell interaction, which is associated with mammary epithelial formation and central nervous system thermoregulation in lactating female . RANK/TNFRSF11A Protein, Human (His) has 175 amino acids (28L-202K), produced by HEK293 cells with C-terminal His-tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

RANK (TNFRSF11A) is a receptor activator of nuclear factor κB (NF-κB), which is involved in bone metabolism and immune system function. RANK is mainly expressed by osteoblasts/stromal cells, and is associated with the formation of giant cell tumor of bone (GCTBs) [1]. RANK combined with RANKL ligand activated the RANKL/RANK/ OPG system to regulate bone resorption [2]. RANKL/RANK is also a regulator of dendritic cell (DC)-T cell interaction, which is associated with mammary epithelial formation and central nervous system thermoregulation in lactating female [3][4]. RANK/TNFRSF11A Protein, Human (His) has 175 amino acids (28L-202K), produced by HEK293 cells with C-terminal His-tag.

Background

RANK (TNFRSF11A), is the receptor activator of nuclear factor-κB (NF-κB), has originally been described to play key roles in bone metabolism and the immune system. RANK belongs to tumor necrosis factor receptor superfamily, acts function during osteoclasts differentiation and activation. RANK expressed by osteoblast/stromal cells, ubiquitous expression with high levels in skeletal muscle, thymus, liver, colon, small intestine and adrenal gland. However, osteoblast typically are present in large numbers in giant cell tumors of bone (GCTBs), suggesting the affect of expressing factors in tumors that stimulate osteoclasts precursor recruitment and differentiation[1]. RANK binds RANKL, the receptor activator of NF-κB ligand, to trigger RANKL/RANK/osteoprotegerin (OPG) system to regulate bone resorption. Specifically, the RANKL/RANK signaling pathway promotes the formation of multicellular osteoclast precursors and ensures the activation and survival of multicellular osteoclasts under normal bone remodeling and various pathological conditions. OPG protects bone from excessive bone resorption by competitively binding to RANKL and hindering RANK binding to RANKL[2]. In addition to RANK's contribution to bone metabolism, the RANKL/RANK system is also involved in dendritic cell (DC)-T cell interactions. In rheumatoid synovium and lymph node pairs, the expression levels of RANK and RANKL can be used as markers to determine the interaction between dendritic cells and T cells[3]. Moreover, RANKL-RANK system is critical in the formation of mammary epithelia in lactating females and the thermoregulation of the central nervous system. As them under the tight control of the female sex hormones estradiol and progesterone, RANKL-RANK causes osteoporosis in postmenopausal women when circulating female sex hormones decrease. Furthermore, RANKL-RANK signaling also plays a critical role in other bone pathologies, bone metastasis or hormone-driven breast cancer[4].

Species

Human

Source

E. coli

Tag

N-His

Accession

Q9Y6Q6 (28L-202K)

Gene ID
Molecular Construction
N-term
His
RANK (28L-202K)
Accession # Q9Y6Q6
C-term
Synonyms
CD265; FEO; TRANCER; Tumor necrosis factor receptor superfamily member 11a NFKB activator
AA Sequence

LQIAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARK

Molecular Weight

Approximately 23.2 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References

RANK/TNFRSF11A Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RANK/TNFRSF11A Protein, Human (His)
Cat. No.:
HY-P71687
Quantity:
MCE Japan Authorized Agent: