1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TNF Superfamily
  4. TNF Receptor Superfamily
  5. Osteoprotegerin
  6. TNFRSF11B/OPG Protein, Human (HEK293, His)

TNFRSF11B/OPG Protein, Human (HEK293, His)

Cat. No.: HY-P70805
COA Handling Instructions

Osteoprotegerin (OPG), a TNF receptor superfamily, is expressed in many tissues including heart, kidney, liver, spleen, and bone marrow. Osteoprotegerin has osteoprotective effect and is critical in bone remodeling. Osteoprotegerin can bind to RANKL and inhibit the binding between TNFSF11 and RANKL, thereby neutralizing the RANKL function in osteoclastogenesis. OPG is also involved in multiple biological processes of cancers. TNFRSF11B/OPG Protein, Human (HEK293, His) is a recombinant human TNFRSF11B/OPG (E22-L401) with C-terminal 6*His tag, which is produced in HEK293 cell.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample (2 μg)   Apply now
2 μg $35 In-stock
10 μg $55 In-stock
50 μg $105 In-stock
100 μg $170 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Osteoprotegerin (OPG), a TNF receptor superfamily, is expressed in many tissues including heart, kidney, liver, spleen, and bone marrow. Osteoprotegerin has osteoprotective effect and is critical in bone remodeling. Osteoprotegerin can bind to RANKL and inhibit the binding between TNFSF11 and RANKL, thereby neutralizing the RANKL function in osteoclastogenesis[1]. OPG is also involved in multiple biological processes of cancers. TNFRSF11B/OPG Protein, Human (HEK293, His) is a recombinant human TNFRSF11B/OPG (E22-L401) with C-terminal 6*His tag, which is produced in HEK293 cell[1][2].

Background

Osteoprotegerin (OPG), a glycoprotein, belongs to TNF receptor superfamily. OPG is expressed in many tissues besides osteoblasts, including heart, kidney, liver, spleen, and bone marrow. Human osteoprotegerin shares <85% aa sequence identity with mouse and rat. Mouse OX40 shares 94.5% aa sequence identity with rat[1].
Osteoprotegerin can bind to RANKL and inhibit the binding between TNFSF11 and RANKL, thereby neutralizing the RANKL function in osteoclastogenesis. Osteoprotegerin also protects large blood vessels from medial calcification. Increased osteoprotegerin levels have been consistently associated with the incidence and prevalence of coronary artery disease[1][3]. Osteoprotegerin is also involved in multiple processes of cancers, such as tumor survival, epithelial to mesenchymal transition (EMT), neo-angiogenesis, invasion, and metastasis[2].
Osteoprotegerin plays a critical role in bone remodeling, and has osteoprotective effect[1].

In Vitro

RANKL (human, 0-100 pg/mL, 36 h) promotes the proliferation of VSMC[5].

In Vivo

Osteoprotegerin (human, 5 mg/kg, i.v.) shows antiresorptive effects in rats[4].

Biological Activity

1. The ability to inhibit TRAIL-mediated cytotoxicity using L 929 mouse fibroblast cells treated with TRAIL has an ED50 value of 10.6 - 96.32 ng/mL.
2. Measured by its ability to inhibit TRAIL-mediated cytotoxicity using A549 cells in the presence of 200 ng/mL TRAIL. The ED50 for this effect is 150.2 ng/mL, corresponding to a specific activity is 6.658×103 units/mg.

  • Measured by its ability to inhibit TRAIL-mediated cytotoxicity using A549 cells in the presence of 200 ng/mL TRAIL. The ED50 for this effect is 150.2 ng/mL, corresponding to a specific activity is 6.658×103 units/mg.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

O00300 (E22-L401)

Gene ID
Molecular Construction
N-term
TNFRSF11B (E22-L401)
Accession # O00300
6*His
C-term
Synonyms
Tumor Necrosis Factor Receptor Superfamily Member 11B; Osteoclastogenesis Inhibitory Factor; Osteoprotegerin; TNFRSF11B; OCIF; OPG
AA Sequence

ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL

Molecular Weight

54-60 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation
References

TNFRSF11B/OPG Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TNFRSF11B/OPG Protein, Human (HEK293, His)
Cat. No.:
HY-P70805
Quantity:
MCE Japan Authorized Agent: