1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TNF Superfamily
  4. TNF Receptor Superfamily
  5. Osteoprotegerin
  6. TNFRSF11B/OPG Protein, Human (HEK293, hFc-Flag)

TNFRSF11B/OPG Protein, Human (HEK293, hFc-Flag)

Cat. No.: HY-P700432
Handling Instructions Technical Support

TNFRSF11B/OPG functions as a decoy receptor for TNFSF11/RANKL, neutralizing its osteoclastogenic effects and promoting osteoclast apoptosis in vitro. Crucial for bone homeostasis, it modulates the TNFSF11/TNFRSF11B ratio. Additionally, TNFRSF11B may prevent arterial calcification, acting as a decoy receptor for TNFSF10/TRAIL to inhibit apoptosis. The homodimeric structure enables TNFRSF11B to interact with TNFSF10 and TNFSF11, regulating essential pathways in bone metabolism and cellular survival. TNFRSF11B/OPG Protein, Human (HEK293, hFc-Flag) is the recombinant human-derived TNFRSF11B/OPG protein, expressed by HEK293, with C-hFc, C-Flag labeled tag. The total length of TNFRSF11B/OPG Protein, Human (HEK293, hFc-Flag) is 380 a.a., with molecular weight of 73.5 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TNFRSF11B/OPG functions as a decoy receptor for TNFSF11/RANKL, neutralizing its osteoclastogenic effects and promoting osteoclast apoptosis in vitro. Crucial for bone homeostasis, it modulates the TNFSF11/TNFRSF11B ratio. Additionally, TNFRSF11B may prevent arterial calcification, acting as a decoy receptor for TNFSF10/TRAIL to inhibit apoptosis. The homodimeric structure enables TNFRSF11B to interact with TNFSF10 and TNFSF11, regulating essential pathways in bone metabolism and cellular survival. TNFRSF11B/OPG Protein, Human (HEK293, hFc-Flag) is the recombinant human-derived TNFRSF11B/OPG protein, expressed by HEK293, with C-hFc, C-Flag labeled tag. The total length of TNFRSF11B/OPG Protein, Human (HEK293, hFc-Flag) is 380 a.a., with molecular weight of 73.5 kDa.

Background

TNFRSF11B/OPG acts as a decoy receptor for TNFSF11/RANKL, effectively neutralizing its function in osteoclastogenesis. Inhibiting the activation of osteoclasts, it promotes their apoptosis in vitro, highlighting its critical role in bone homeostasis by modulating the local ratio between TNFSF11 and TNFRSF11B. Furthermore, TNFRSF11B may play a role in preventing arterial calcification and act as a decoy receptor for TNFSF10/TRAIL, offering protection against apoptosis. The homodimeric structure of TNFRSF11B underscores its ability to interact with TNFSF10 and TNFSF11, thus regulating essential pathways in bone metabolism and cellular survival.

Species

Human

Source

HEK293

Tag

C-hFc;C-Flag

Accession

O00300 (E22-L401)

Gene ID
Molecular Construction
N-term
TNFRSF11B (E22-L401)
Accession # O00300
hFc-Flag
C-term
Synonyms
Tumor Necrosis Factor Receptor Superfamily Member 11B; Osteoclastogenesis Inhibitory Factor; Osteoprotegerin; TNFRSF11B; OCIF; OPG
AA Sequence

ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL

Molecular Weight

73.5 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

TNFRSF11B/OPG Protein, Human (HEK293, hFc-Flag) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TNFRSF11B/OPG Protein, Human (HEK293, hFc-Flag)
Cat. No.:
HY-P700432
Quantity:
MCE Japan Authorized Agent: