1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TNF Superfamily
  4. TNF Receptor Superfamily
  5. Osteoprotegerin
  6. TNFRSF11B/OPG Protein, Rhesus Macaque (hFc)

Osteoprotegerin (OPG), a TNF receptor superfamily, is expressed in many tissues including heart, kidney, liver, spleen, and bone marrow. Osteoprotegerin has osteoprotective effect and is critical in bone remodeling. Osteoprotegerin can bind to RANKL and inhibit the binding between TNFSF11 and RANKL, thereby neutralizing the RANKL function in osteoclastogenesis. OPG is also involved in multiple biological processes of cancers. TNFRSF11B/OPG Protein, Rhesus Macaque (hFc) is a recombinant Rhesus Macaque TNFRSF11B/OPG (M28-L428) with C-terminal hFc tag, which is produced in HEK293 cell.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Osteoprotegerin (OPG), a TNF receptor superfamily, is expressed in many tissues including heart, kidney, liver, spleen, and bone marrow. Osteoprotegerin has osteoprotective effect and is critical in bone remodeling. Osteoprotegerin can bind to RANKL and inhibit the binding between TNFSF11 and RANKL, thereby neutralizing the RANKL function in osteoclastogenesis[1]. OPG is also involved in multiple biological processes of cancers. TNFRSF11B/OPG Protein, Rhesus Macaque (hFc) is a recombinant Rhesus Macaque TNFRSF11B/OPG (M28-L428) with C-terminal hFc tag, which is produced in HEK293 cell[1][2].

Background

Osteoprotegerin (OPG), a glycoprotein, belongs to TNF receptor superfamily. OPG is expressed in many tissues besides osteoblasts, including heart, kidney, liver, spleen, and bone marrow. Human osteoprotegerin shares <85% aa sequence identity with mouse and rat. Mouse OX40 shares 94.5% aa sequence identity with rat[1].
Osteoprotegerin can bind to RANKL and inhibit the binding between TNFSF11 and RANKL, thereby neutralizing the RANKL function in osteoclastogenesis. Osteoprotegerin also protects large blood vessels from medial calcification. Increased osteoprotegerin levels have been consistently associated with the incidence and prevalence of coronary artery disease[1][3]. Osteoprotegerin is also involved in multiple processes of cancers, such as tumor survival, epithelial to mesenchymal transition (EMT), neo-angiogenesis, invasion, and metastasis[2].
Osteoprotegerin plays a critical role in bone remodeling, and has osteoprotective effect[1].

In Vitro

RANKL (human, -1 pg/mL, 36 h) promotes the proliferation of VSMC[5].

In Vivo

Osteoprotegerin (human, 5 mg/kg, i.v.) shows antiresorptive effects in rats[4].

Biological Activity

Measured by its ability to inhibit TRAIL-mediated cytotoxicity using L 929 mouse fibroblast cells treated with TRAIL. The ED50 for this effect is 6.472 ng/mL in the presence of 20 ng/mL of recombinant human TRAIL, corresponding to a specific activity is 1.545×10[5] units/mg.

  • Measured by its ability to inhibit TRAIL-mediated cytotoxicity using L 929 mouse fibroblast cells treated with TRAIL.The ED50 for this effect is 6.472 ng/mL in the presence of 20 ng/mL of recombinant human TRAIL, corresponding to a specific activity is 1.545×105 units/mg.
Species

Rhesus Macaque

Source

HEK293

Tag

C-hFc

Accession

XP_001096915 (M28-L428)

Gene ID
Molecular Construction
N-term
TNFRSF11B (M28-L428)
Accession # XP_001096915
hFc
C-term
Synonyms
OCIF; OPG; OPGtumor necrosis factor receptor superfamily member 11B
AA Sequence

MNKLLCCALVFLDISIKWTTQETFPPKYLHYDQETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRRHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTTKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL

Molecular Weight

Approximately 80-95 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

TNFRSF11B/OPG Protein, Rhesus Macaque (hFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TNFRSF11B/OPG Protein, Rhesus Macaque (hFc)
Cat. No.:
HY-P74661
Quantity:
MCE Japan Authorized Agent: