TNFRSF3/LTBR Protein, Mouse (HEK293, Fc)

TNFRSF3/LTBR Protein, Mouse (HEK293, Fc) is a cell surface receptor for apoptotic and cytokine-released lymphotoxins involved in activation of gene transcription programs and cell death, and is important in immune development and host defense. TNFRSF3/LTBR Protein, Mouse (HEK293, Fc) is expressed by HEK293 cells and is a transmembrane protein with a Fc tag at the C-terminus^[1].

Lymphotoxin beta receptor (LTBR), also known as tumor necrosis factor receptor superfamily member 3 (TNFRSF3), is a member of the tumor necrosis factor receptor superfamily and a cell surface receptor for lymphotoxins involved in apoptosis and cytokine release. LTBR is expressed on the surface of most cell types, including breast, colorectal, lung, gastric, melanoma, and bladder cancers , while its ligands lymphotoxin (LT) a1b2 and TNF superfamily member 14 (TNFSF14; also known as LIGHT), are mainly expressed on the surface of immune cells. The LTBR signaling pathway may be involved in the activation of responses that control cell differentiation, growth and death, as manifested by the formation of peripheral lymphoid-like organs, especially secondary and tertiary lymphoid structures critical for tissue, dendritic cell homeostasis, liver regeneration, interferon response to pathogens and death in mucosa-derived carcinomas. LTβR signaling may facilitate communication between infiltrating immune cells and tumor cells. Triggering LTβR induces typical and atypical nuclear factor (NF)-κB signaling pathways that are associated with inflammation-induced oncogenic effects. Sustained LTβR signaling also leads to NF-κB-mediated chronic inflammation and the development of hepatocellular carcinoma (HCC)^[1][2].

LTβR is involved in lymphoid tissue development and LTβR^-/- mice lack lymph nodes, colon-associated lymphoid tissue and all lymph nodes. At the same time, LTβR is required for the coordinated formation of the spleen microenvironment, and LTβR -/- mice shows significant alterations in spleen microarchitecture. In this case, B cells are not organized in follicles but are mixed with T cells around the small central artery^[3].

Measured by its binding ability in a functional ELISA. Immobilized Mouse LTBR at 5 μg/ml (100 μL/well) can bind biotinylated Mouse LIGHT. The ED₅₀ for this effect is 60.67 ng/mL.

Mouse

HEK293

C-hFc

P50284 (S28-P218)

17000  [NCBI]

SQPQLVPPYRIENQTCWDQDKEYYEPMHDVCCSRCPPGEFVFAVCSRSQDTVCKTCPHNSYNEHWNHLSTCQLCRPCDIVLGFEEVAPCTSDRKAECRCQPGMSCVYLDNECVHCEEERLVLCQPGTEAEVTDEIMDTDVNCVPCKPGHFQNTSSPRARCQPHTRCEIQGLVEAAPGTSYSDTICKNPPEP

Approximately 61.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.

• [1]. Norris PS, et al. The LT beta R signaling pathway. Adv Exp Med Biol. 2007;597:160-72.  [Content Brief]

  [2]. Mo Shen, et al. Lymphotoxin β receptor activation promotes mRNA expression of RelA and pro-inflammatory cytokines TNFα and IL-1β in bladder cancer cells. Mol Med Rep. 2017 Jul;16(1):937-942.  [Content Brief]

  [3]. Fütterer A, et al. The lymphotoxin beta receptor controls organogenesis and affinity maturation in peripheral lymphoid tissues. Immunity. 1998 Jul;9(1):59-70.  [Content Brief]