1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TNF Superfamily
  4. TNF Receptor Superfamily
  5. Lymphotoxin β Receptor
  6. TNFRSF3/LTBR Protein, Human (HEK293, His)

TNFRSF3/LTBR Protein, Human (HEK293, His) is a cell surface receptor for apoptotic and cytokine-released lymphotoxins involved in activation of gene transcription programs and cell death, and is important in immune development and host defense. TNFRSF3/LTBR Protein, Human (HEK293, His) is expressed by HEK293 cells and is a transmembrane protein (L228-W248) with a His tag at the C-terminus.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg USD 72 In-stock
50 μg USD 168 In-stock
100 μg USD 250 Get quote
> 100 μg   Get quote  

Get it by April 21 for select sizes. Order within 11 hrs 46 mins.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

TNFRSF3/LTBR Protein, Human (HEK293, His) is a cell surface receptor for apoptotic and cytokine-released lymphotoxins involved in activation of gene transcription programs and cell death, and is important in immune development and host defense. TNFRSF3/LTBR Protein, Human (HEK293, His) is expressed by HEK293 cells and is a transmembrane protein (L228-W248) with a His tag at the C-terminus[1].

Background

Lymphotoxin beta receptor (LTBR), also known as tumor necrosis factor receptor superfamily member 3 (TNFRSF3), is a member of the tumor necrosis factor receptor superfamily and a cell surface receptor for lymphotoxins involved in apoptosis and cytokine release. LTBR is expressed on the surface of most cell types, including breast, colorectal, lung, gastric, melanoma, and bladder cancers , while its ligands lymphotoxin (LT) a1b2 and TNF superfamily member 14 (TNFSF14; also known as LIGHT), are mainly expressed on the surface of immune cells. The LTBR signaling pathway may be involved in the activation of responses that control cell differentiation, growth and death, as manifested by the formation of peripheral lymphoid-like organs, especially secondary and tertiary lymphoid structures critical for tissue, dendritic cell homeostasis, liver regeneration, interferon response to pathogens and death in mucosa-derived carcinomas. LTβR signaling may facilitate communication between infiltrating immune cells and tumor cells. Triggering LTβR induces typical and atypical nuclear factor (NF)-κB signaling pathways that are associated with inflammation-induced oncogenic effects. Sustained LTβR signaling also leads to NF-κB-mediated chronic inflammation and the development of hepatocellular carcinoma (HCC)[1][2].

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P36941-1 (Q31-M227)

Gene ID
Molecular Construction
N-term
LTBR (Q31-M227)
Accession # P36941-1
6*His
C-term
Synonyms
rHuTumor necrosis factor receptor superfamily member 3/TNFRSF3, His; Tumor Necrosis Factor Receptor Superfamily Member 3; Lymphotoxin-Beta Receptor; Tumor Necrosis Factor C Receptor; Tumor Necrosis Factor Receptor 2-Related Protein; Tumor Necrosis Factor Receptor Type III; TNF-RIII; TNFR-III; LTBR; D12S370; TNFCR; TNFR3; TNFRSF3
AA Sequence

QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLM

Molecular Weight

29-40 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation
References

TNFRSF3/LTBR Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • How should lyophilized recombinant proteins be reconstituted and stored?

    1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss. 2. Taking 10 μg as an example, first add 20 μL of reconstituted solution provided by MCE and use a pipette to gently resuspend the lyophilized protein until it is fully dissolved.. (For most proteins, the reconstitution solution we provide is sterile water. If a diluent other than water is required, it will be indicated in the product's Certificate of Analysis (COA).). 3. Add an additional 80 μL of buffer/culture medium containing carrier protein (either 0.1% BSA, 5% HSA, 10% FBS, or 5% trehalose), and then use a pipette to gently mix until uniform. The final concentration is should not be lower than 100 μg/mL. 4. Aliquot at least 20 μL per tube. 5. After aliquoting, store it frozen at a temperature ranging from -20ºC to -80ºC, and it can be preserved for 3 to 6 months.

  • How should solution-form recombinant proteins be stored?

    1. The product can be stored in its original form and diluted as needed upon use. 2. Alternatively, dilute with a buffer/culture medium containing a carrier protein (either 0.1% BSA, 5% HSA, 10% FBS, or 5% alginate), mix well by pipetting, and ensure that

  • Why is it necessary to add carrier proteins?

    Carrier proteins are commonly added to enhance the stability of recombinant proteins, preventing them from adhering to the walls of the container during freezing or thawing processes. Plastic tubes have a certain adsorptive capacity for proteins, which may lead to difficulty in separating the protein from the tube walls, resulting in a decrease in the actual concentration of the protein in the solution and thus affecting its activity. To minimize such losses, it is recommended to add a commonly used carrier protein solution prior to the long-term storage of recombinant protein products.

  • Carrier protein types and options?

    In cases where the carrier protein is not expected to influence the experimental outcomes, an appropriate carrier protein, such as 0.1% BSA (Bovine Serum Albumin), 5% HSA (Human Serum Albumin), 10% FBS (Fetal Bovine Serum), or 5% trehalose, can be incorpo

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TNFRSF3/LTBR Protein, Human (HEK293, His)
Cat. No.:
HY-P70345
Quantity:
MCE Japan Authorized Agent: