1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TNF Superfamily
  4. TNF Superfamily Ligands
  5. TL1A
  6. TL1A/TNFSF15 Protein, Human (O95150-2, HEK293, His)

TL1A/TNFSF15 Protein, Human (O95150-2, HEK293, His)

Cat. No.: HY-P71981
Handling Instructions Technical Support

TL1A/TNFSF15 Protein, the receptor for TNFRSF25 and TNFRSF6B, activates NF-kappa-B and promotes caspase activation, leading to apoptosis. It also inhibits vascular endothelial growth and angiogenesis in vitro. Operating as a homotrimer, it plays a crucial role in diverse cellular processes, including immune response and apoptosis regulation. TL1A/TNFSF15 Protein, Human (O95150-2, HEK293, His) is the recombinant human-derived TL1A/TNFSF15 protein, expressed by HEK293 , with labeled tag. The total length of TL1A/TNFSF15 Protein, Human (O95150-2, HEK293, His) is 192 a.a., with molecular weight of ~33 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TL1A/TNFSF15 Protein, the receptor for TNFRSF25 and TNFRSF6B, activates NF-kappa-B and promotes caspase activation, leading to apoptosis. It also inhibits vascular endothelial growth and angiogenesis in vitro. Operating as a homotrimer, it plays a crucial role in diverse cellular processes, including immune response and apoptosis regulation. TL1A/TNFSF15 Protein, Human (O95150-2, HEK293, His) is the recombinant human-derived TL1A/TNFSF15 protein, expressed by HEK293 , with labeled tag. The total length of TL1A/TNFSF15 Protein, Human (O95150-2, HEK293, His) is 192 a.a., with molecular weight of ~33 kDa.

Background

TL1A/TNFSF15 Protein acts as the receptor for TNFRSF25 and TNFRSF6B, facilitating the activation of NF-kappa-B and promoting the activation of caspases, leading to apoptosis. Additionally, it exhibits inhibitory effects on vascular endothelial growth and angiogenesis in vitro. The protein functions as a homotrimer, underscoring its role in diverse cellular processes, including immune response and apoptosis regulation.

Species

Human

Source

HEK293

Tag

N-10*His

Accession

O95150-2 (M1-L192)

Gene ID
Molecular Construction
N-term
10*His
TL1A (M1-L192)
Accession # O95150-2
C-term
Synonyms
MGC129934; MGC129935; TL1 A; tl1; tl1a; tnf ligand related molecule 1; TNF ligand-related molecule 1; tnf superfamily ligand tl1a; TNF15_HUMAN; TNFSF15; Tumor necrosis factor ligand; superfamily member 15; Tumor necrosis factor ligand superfamily member 15; Tumor necrosis factor ligand superfamily member 15, secreted form; Vascular endothelial cell growth inhibitor; Vascular endothelial growth inhibitor 192a; Vascular endothelial growth inhibitor; vegi; VEGI192A
AA Sequence

MQLTKGRLHFSHPLSHTKHISPFVTDAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL

Molecular Weight

Approximately 33 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

TL1A/TNFSF15 Protein, Human (O95150-2, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TL1A/TNFSF15 Protein, Human (O95150-2, HEK293, His)
Cat. No.:
HY-P71981
Quantity:
MCE Japan Authorized Agent: