1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TPO/Thrombopoietin Protein, Human (HEK293, C/N-His)

TPO/Thrombopoietin Protein, Human (HEK293, C/N-His)

Cat. No.: HY-P70637
SDS COA Handling Instructions Technical Support

TPO/Thrombopoietin Protein, Human (HEK 293, His) is a recombinant protein produced in HEK293 cells with a His tag. TPO is a growth factor for the megakaryocytic/platelet lineage.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

TPO/Thrombopoietin Protein, Human (HEK 293, His) is a recombinant protein produced in HEK293 cells with a His tag. TPO is a growth factor for the megakaryocytic/platelet lineage.

Background

Thrombopoietin (TPO) is a growth factor for the megakaryocytic/platelet lineage. TPO is expressed in the neurons of the human central nervous system and is neuroprotective. TPO is the key enzyme in the biosynthesis of thyroid hormones T3 and T4[1][2].

Biological Activity

Measured in a cell proliferation assay using MO7e human megakaryocytic leukemic cells. The ED50 for this effect is 11.69 ng/mL, corresponding to a specific activity is 8.55×104 units/mg.

Species

Human

Source

HEK293

Tag

N-6*His;C-6*His

Accession

P40225 (S22-G353)

Gene ID
Molecular Construction
N-term
6*His
TPO (S22-G353)
Accession # P40225
6*His
C-term
Synonyms
Thrombopoietin; C-mpl ligand; Megakaryocyte colony-stimulating factor; Megakaryocyte growth and development factor; Myeloproliferative leukemia virus oncogene ligand; THPO
AA Sequence

SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG

Molecular Weight

70-90 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris,150 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

TPO/Thrombopoietin Protein, Human (HEK293, C/N-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TPO/Thrombopoietin Protein, Human (HEK293, C/N-His)
Cat. No.:
HY-P70637
Quantity:
MCE Japan Authorized Agent: