TPO/Thrombopoietin Protein, Human (HEK293, C-His)

TPO/Thrombopoietin Protein, Human (HEK 293, His) is a recombinant protein produced in HEK293 cells with a His tag. TPO is a growth factor for the megakaryocytic/platelet lineage.

Thrombopoietin (TPO) is a growth factor for the megakaryocytic/platelet lineage. TPO is expressed in the neurons of the human central nervous system and is neuroprotective. TPO is the key enzyme in the biosynthesis of thyroid hormones T3 and T4^[1][2].

Measured  in a cell proliferation assay using MO7e human megakaryocytic leukemic cells.  The ED₅₀ for this effect is 3.063 ng/mL, corresponding to a specific  activity is 3.265×10⁵ units/mg.

Human

HEK293

C-6*His

P40225 (S22-G353)

7066  [NCBI]

SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG

approximately 73 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.