1. Recombinant Proteins
  2. Others
  3. TPPP2 Protein, Human (His)

TPPP2 Protein, Human (His)

Cat. No.: HY-P77253
SDS COA Handling Instructions

The TPPP2 protein may be a regulator of microtubule dynamics and is critical for sperm motility. Unlike other family members, TPPP2 lacks microtubule bundling activity, suggesting a unique functional role. TPPP2 Protein, Human (His) is the recombinant human-derived TPPP2 protein, expressed by E. coli , with N-His labeled tag. The total length of TPPP2 Protein, Human (His) is 170 a.a., with molecular weight of 18-21 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The TPPP2 protein may be a regulator of microtubule dynamics and is critical for sperm motility. Unlike other family members, TPPP2 lacks microtubule bundling activity, suggesting a unique functional role. TPPP2 Protein, Human (His) is the recombinant human-derived TPPP2 protein, expressed by E. coli , with N-His labeled tag. The total length of TPPP2 Protein, Human (His) is 170 a.a., with molecular weight of 18-21 kDa.

Background

The TPPP2 protein emerges as a probable regulator of microtubule dynamics crucial for sperm motility. In contrast to other members of its protein family, TPPP2 lacks microtubule bundling activity, suggesting a unique functional role within microtubule-associated processes. Its involvement in regulating microtubule dynamics underscores its significance in orchestrating the complex machinery required for sperm motility. Further investigation into the specific molecular mechanisms governed by TPPP2 and its distinct characteristics within the microtubule regulatory landscape will contribute to a more comprehensive understanding of its role in facilitating sperm motility.

Species

Human

Source

E. coli

Tag

N-His

Accession

P59282 (M1-K170)

Gene ID

122664  [NCBI]

Molecular Construction
N-term
His
TPPP2 (M1-K170)
Accession # P59282
C-term
Synonyms
Tubulin polymerization-promoting protein family member 2; Protein p25-beta; TPPP/p18; C14orf8
AA Sequence

MASEAEKTFHRFAAFGESSSSGTEMNNKNFSKLCKDCGIMDGKTVTSTDVDIVFSKVKAKNARTITFQQFKEAVKELGQKRFKGKSPDEVLENIYGLMEGKDPATTGATKATTVGAVDRLTDTSKYTGTHKERFDESGKGKGIAGREEMTDNTGYVSGYKGSGTYDKKTK

Molecular Weight

Approximately 19 kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TPPP2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TPPP2 Protein, Human (His)
Cat. No.:
HY-P77253
Quantity:
MCE Japan Authorized Agent: