TPPP2 Protein, Human (His)

The TPPP2 protein may be a regulator of microtubule dynamics and is critical for sperm motility. Unlike other family members, TPPP2 lacks microtubule bundling activity, suggesting a unique functional role. TPPP2 Protein, Human (His) is the recombinant human-derived TPPP2 protein, expressed by E. coli , with N-His labeled tag. The total length of TPPP2 Protein, Human (His) is 170 a.a., with molecular weight of 18-21 kDa.

The TPPP2 protein emerges as a probable regulator of microtubule dynamics crucial for sperm motility. In contrast to other members of its protein family, TPPP2 lacks microtubule bundling activity, suggesting a unique functional role within microtubule-associated processes. Its involvement in regulating microtubule dynamics underscores its significance in orchestrating the complex machinery required for sperm motility. Further investigation into the specific molecular mechanisms governed by TPPP2 and its distinct characteristics within the microtubule regulatory landscape will contribute to a more comprehensive understanding of its role in facilitating sperm motility.

Human

E. coli

N-His

P59282 (M1-K170)

122664  [NCBI]

MASEAEKTFHRFAAFGESSSSGTEMNNKNFSKLCKDCGIMDGKTVTSTDVDIVFSKVKAKNARTITFQQFKEAVKELGQKRFKGKSPDEVLENIYGLMEGKDPATTGATKATTVGAVDRLTDTSKYTGTHKERFDESGKGKGIAGREEMTDNTGYVSGYKGSGTYDKKTK

Approximately 19 kDa

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.