TRAIL R2/TNFRSF10B Protein, Human (HEK293)

TRAIL R2/TNFRSF10B Protein, Human (HEK293) is a cell surface receptor of the TNF-receptor superfamily that binds TRAIL and mediates apoptosis.

TNFRSF10B can be activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL/APO-2L), and transduces apoptosis signal. TNFRSF10B inhibits tumor formation through apoptosis but deregulation encourages metastasis, migration and invasion of tumor cell tissues^[1].

1. The ED₅₀ is <6 ng/mL as measured by RPMI-8226 cells, corresponding to a specific activity of >1.0 × 10⁶ units/mg.
2. Measured by its ability to inhibit TRAIL-mediated cytotoxicity using A549 cells treated with TRAIL. The ED₅₀ for this effect is 43.96 ng/mL, corresponding to a specific activity is 2.275×10⁴ units/mg.

• 
  Measured by its ability to inhibit TRAIL-mediated cytotoxicity using A549 cells treated with TRAIL. The ED₅₀ for this effect is 43.96 ng/mL, corresponding to a specific activity is 2.275×10⁴ units/mg.

Human

HEK293

Tag Free

O14763 (A54-E182)

8795  [NCBI]

ALITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE

Approximately 16.22 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB,150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Tahir RA, et al. Tumor necrosis factor receptor superfamily 10B (TNFRSF10B): an insight from structure modeling to virtual screening for designing drug against head and neck cancer. Theor Biol Med Model. 2013 Jun 1;10:38.  [Content Brief]