TRAILR4/TNFRSF10D Protein, Human (HEK293, Fc)

TRAILR4/TNFRSF10D protein is a receptor for TRAIL and lacks the ability to induce apoptosis due to the truncated death domain. Paradoxically, not only does it fail to induce apoptosis, but it also prevents TRAIL-mediated apoptosis. TRAILR4/TNFRSF10D Protein, Human (HEK293, Fc) is the recombinant human-derived TRAILR4/TNFRSF10D protein, expressed by HEK293 , with C-hFc labeled tag. The total length of TRAILR4/TNFRSF10D Protein, Human (HEK293, Fc) is 156 a.a., with molecular weight of 50-70 kDa.

The TRAILR4/TNFRSF10D Protein functions as a receptor for the cytotoxic ligand TRAIL, although it contains a truncated death domain, rendering it incapable of inducing apoptosis. Paradoxically, TRAILR4/TNFRSF10D not only fails to induce apoptosis but also serves a protective role against TRAIL-mediated apoptosis. There is conflicting information regarding its ability to activate the NF-kappa-B pathway, with some studies suggesting that it cannot induce this pathway, while others propose that it has the capability to activate NF-kappa-B. The dual nature of TRAILR4/TNFRSF10D in interacting with TRAIL, both as a receptor and as a protective factor against apoptosis, underscores the complexity of its regulatory functions in cellular responses to TRAIL signaling.

Human

HEK293

C-hFc

Q9UBN6 (A56-H211)

8793  [NCBI]

ATIPRQDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNKSSCTTTRDTVCQCEKGSFQDKNSPEMCRTCRTGCPRGMVKVSNCTPRSDIKCKNESAASSTGKTPAAEETVTTILGMLASPYH

50-70 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.