Transmembrane protease serine 4 Protein, Mouse (His-SUMO)

The transmembrane protease serine 4 (TMPRSS4) protein is a plasma membrane-anchored serine protease that is critical for activating molecular pathways. Its proteolytic activity directly processes pro-uPA/PLAU into its active form. Transmembrane protease serine 4 Protein, Mouse (His-SUMO) is the recombinant mouse-derived Transmembrane protease serine 4 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

The Transmembrane Protease Serine 4 (TMPRSS4) Protein, a plasma membrane-anchored serine protease, plays a pivotal role in the activation of various molecular pathways. Through its proteolytic activity, TMPRSS4 directly induces the processing of pro-uPA/PLAU, converting it into its active form. Additionally, TMPRSS4 exhibits the capability to activate epithelial sodium channels (ENaC). This dual functionality underscores the significance of TMPRSS4 in regulating crucial cellular processes, emphasizing its potential impact on protease-mediated cascades and ion channel activation in diverse physiological contexts.

Mouse

E. coli

N-His;N-SUMO

Q8VCA5 (K52-M435)

214523  [NCBI]

KVILDKYYFICGSPLTFIQRGQLCDGHLDCASGEDEEHCVKDFPEKPGVAVRLSKDRSTLQVLDAATGTWASVCFDNFTEALAKTACRQMGYDSQPAFRAVEIRPDQNLPVAQVTGNSQELQVQNGSRSCLSGSLVSLRCLDCGKSLKTPRVVGGVEAPVDSWPWQVSIQYNKQHVCGGSILDPHWILTAAHCFRKYLDVSSWKVRAGSNILGNSPSLPVAKIFIAEPNPLYPKEKDIALVKLQMPLTFSGSVRPICLPFSDEVLVPATPVWVIGWGFTEENGGKMSDMLLQASVQVIDSTRCNAEDAYEGEVTAEMLCAGTPQGGKDTCQGDSGGPLMYHSDKWQVVGIVSWGHGCGGPSTPGVYTKVTAYLNWIYNVRKSEM

Approximately 57.8 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.