TRAT1 Protein, Human (His)

TRAT1 protein stabilizes the T-cell antigen receptor (TCR)/CD3 complex on T-cell surfaces. As a homodimer linked by disulfide bonds, TRAT1 interacts with CD3Z, enhancing the structural integrity and function of the TCR/CD3 complex. Phosphorylated TRAT1 also engages with PIK3R1, indicating its role in signaling pathways related to T-cell activation and response. TRAT1 Protein, Human (His) is the recombinant human-derived TRAT1 protein, expressed by E. coli , with C-6*His labeled tag. The total length of TRAT1 Protein, Human (His) is 158 a.a., with molecular weight of ~30.0 kDa.

T Cell Receptor-Associated Transmembrane Adaptor 1 (TRAT1) protein functions as a stabilizer for the T-cell antigen receptor (TCR)/CD3 complex on the surface of T-cells. Existing as a homodimer through disulfide linkages, TRAT1 engages in interactions with CD3Z, contributing to the structural integrity and proper functioning of the TCR/CD3 complex. Upon phosphorylation, TRAT1 further interacts with PIK3R1, suggesting its involvement in signaling pathways associated with T-cell activation and response.

Human

E. coli

C-6*His

Q6PIZ9 (N29-N186)

50852  [NCBI]

NISHYVEKQRQDKMYSYSSDHTRVDEYYIEDTPIYGNLDDMISEPMDENCYEQMKARPEKSVNKMQEATPSAQATNETQMCYASLDHSVKGKRRKPRKQNTHFSDKDGDEQLHAIDASVSKTTLVDSFSPESQAVEENIHDDPIRLFGLIRAKREPIN

Approximately 30.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 1 mM EDTA, 20% Glycerol, pH 8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.