1. Recombinant Proteins
  2. Others
  3. TREM-2 Protein, Mouse (HEK293, His)

TREM-2 Protein, Mouse (HEK293, His)

Cat. No.: HY-P71381
SDS COA Handling Instructions

TREM-2 protein forms a signaling complex with TYROBP, activates cells upon ligand binding, and acts as a receptor for amyloid beta, lipoproteins, and apolipoproteins. It promotes their uptake by microglia, triggering activation, proliferation, migration, apoptosis and cytokine expression. TREM-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TREM-2 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample (5 μg)   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TREM-2 protein forms a signaling complex with TYROBP, activates cells upon ligand binding, and acts as a receptor for amyloid beta, lipoproteins, and apolipoproteins. It promotes their uptake by microglia, triggering activation, proliferation, migration, apoptosis and cytokine expression. TREM-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TREM-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

TREM-2 Protein forms a receptor signaling complex with TYROBP, mediating signaling and cell activation upon ligand binding. It acts as a receptor for amyloid-beta protein 42, facilitating its uptake and degradation by microglia, resulting in microglial activation, proliferation, migration, apoptosis, and cytokine expression. Additionally, TREM-2 serves as a receptor for lipoprotein particles and apolipoproteins, enhancing their uptake in microglia. It binds phospholipids and regulates microglial proliferation, phagocytosis of apoptotic neurons, and response to oxidative stress. Furthermore, TREM-2 suppresses PI3K and NF-kappa-B signaling, promotes anti-apoptotic NF-kappa-B signaling during oxidative stress, and plays a role in microglial MTOR activation and metabolism. It is involved in age-related changes in microglial numbers and triggers immune responses in macrophages and dendritic cells. TREM-2 also mediates cytokine-induced multinucleated giant cell formation and is implicated in osteoclast differentiation. The protein interacts with TYROBP, and this interaction is crucial for stabilizing the TREM-2 C-terminal fragment.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Mouse TREM2, at 1 μg/mL (100 μL/well) can bind Anti-TREM2 Antibody, the ED50 is ≤46.44 ng/mL, corresponding to a specific activity is ≥2.153×104 units/mg.

  • Measured by its binding ability in a functional ELISA. Immobilized Mouse TREM2, at 1 μg/mL (100 μL/well) can bind Anti-TREM2 Antibody, the ED50 is 15.42 ng/mL.
Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q99NH8-1 (L19-P168)

Gene ID
Molecular Construction
N-term
TREM-2 (L19-P168)
Accession # Q99NH8-1
6*His
C-term
Synonyms
Triggering Receptor Expressed on Myeloid Cells 2b; Triggering receptor expressed on myeloid cells 2; TREM-2; Triggering receptor expressed on monocytes 2; Trem2; Trem2a; Trem2b; Trem2c; TREM-2b
AA Sequence

LNTTVLQGMAGQSLRVSCTYDALKHWGRRKAWCRQLGEEGPCQRVVSTHGVWLLAFLKKRNGSTVIADDTLAGTVTITLKNLQAGDAGLYQCQSLRGREAEVLQKVLVEVLEDPLDDQDAGDLWVPEESSSFEGAQVEHSTSRNQETSFP

Molecular Weight

Approximately 27-40 kDa due to the glycosylation.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4 or 20 mM Tris-HCl, 8% Trehaolse, 2%Mannitol, 0.05% Tween 80, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TREM-2 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TREM-2 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P71381
Quantity:
MCE Japan Authorized Agent: