TREML1 Protein, Human (147a.a, HEK293, His)

TREML1 (triggering receptor expressed on myeloid cells, like 1) is a cell surface receptor that may play a role in innate and adaptive immune responses. When phosphorylated, TREML1 interacts with the proteins PTPN6 and PTPN11, suggesting that it may be involved in regulating signaling pathways related to immune processes. TREML1 Protein, Human (147a.a, HEK293, His) is the recombinant human-derived TREML1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of TREML1 Protein, Human (147a.a, HEK293, His) is 147 a.a., with molecular weight of ~20.0 kDa.

TREML1 (Triggering Receptor Expressed on Myeloid Cells Like 1) is a cell surface receptor that likely plays a role in both innate and adaptive immune responses. When phosphorylated, TREML1 interacts with proteins PTPN6 and PTPN11, indicating its potential involvement in regulating signaling pathways associated with immune processes. This suggests that TREML1 may have a significant impact on immune system function and could be a target for further investigation in understanding immune responses and developing therapeutic interventions.

Human

HEK293

C-6*His

Q86YW5 (Q16-P162)

340205  [NCBI]

QGIVGSLPEVLQAPVGSSILVQCHYRLQDVKAQKVWCRFLPEGCQPLVSSAVDRRAPAGRRTFLTDLGGGLLQVEMVTLQEEDAGEYGCMVDGARGPQILHRVSLNILPPEEEEETHKIGSLAENAFSDPAGSANPLEPSQDEKSIP

Approximately 20.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.