1. Recombinant Proteins
  2. Receptor Proteins
  3. TREML1 Protein, Human (147a.a, HEK293, His)

TREML1 (triggering receptor expressed on myeloid cells, like 1) is a cell surface receptor that may play a role in innate and adaptive immune responses. When phosphorylated, TREML1 interacts with the proteins PTPN6 and PTPN11, suggesting that it may be involved in regulating signaling pathways related to immune processes. TREML1 Protein, Human (147a.a, HEK293, His) is the recombinant human-derived TREML1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of TREML1 Protein, Human (147a.a, HEK293, His) is 147 a.a., with molecular weight of ~20.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TREML1 (triggering receptor expressed on myeloid cells, like 1) is a cell surface receptor that may play a role in innate and adaptive immune responses. When phosphorylated, TREML1 interacts with the proteins PTPN6 and PTPN11, suggesting that it may be involved in regulating signaling pathways related to immune processes. TREML1 Protein, Human (147a.a, HEK293, His) is the recombinant human-derived TREML1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of TREML1 Protein, Human (147a.a, HEK293, His) is 147 a.a., with molecular weight of ~20.0 kDa.

Background

TREML1 (Triggering Receptor Expressed on Myeloid Cells Like 1) is a cell surface receptor that likely plays a role in both innate and adaptive immune responses. When phosphorylated, TREML1 interacts with proteins PTPN6 and PTPN11, indicating its potential involvement in regulating signaling pathways associated with immune processes. This suggests that TREML1 may have a significant impact on immune system function and could be a target for further investigation in understanding immune responses and developing therapeutic interventions.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q86YW5 (Q16-P162)

Gene ID
Molecular Construction
N-term
TREML1 (Q16-P162)
Accession # Q86YW5
6*His
C-term
Synonyms
Trem-Like Transcript 1 Protein; TLT-1; Triggering Receptor Expressed on Myeloid Cells-Like Protein 1; TREML1; TLT1
AA Sequence

QGIVGSLPEVLQAPVGSSILVQCHYRLQDVKAQKVWCRFLPEGCQPLVSSAVDRRAPAGRRTFLTDLGGGLLQVEMVTLQEEDAGEYGCMVDGARGPQILHRVSLNILPPEEEEETHKIGSLAENAFSDPAGSANPLEPSQDEKSIP

Molecular Weight

Approximately 20.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

TREML1 Protein, Human (147a.a, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TREML1 Protein, Human (147a.a, HEK293, His)
Cat. No.:
HY-P71382
Quantity:
MCE Japan Authorized Agent: