1. Recombinant Proteins
  2. Others
  3. TRIM21 Protein, Mouse (His-SUMO)

TRIM21 is an E3 ubiquitin protein ligase that forms complexes with E2 enzymes including UBE2D1 and UBE2E2.It cooperates with UBE2D2 to ubiquitinate USP4, IKBKB and itself, and binds to SCF E3 ligase to mediate ubiquitination of CDKN1B.TRIM21 Protein, Mouse (His-SUMO) is the recombinant mouse-derived TRIM21 protein, expressed by E.coli , with N-His, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

TRIM21 Protein, Mouse (His-SUMO) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TRIM21 is an E3 ubiquitin protein ligase that forms complexes with E2 enzymes including UBE2D1 and UBE2E2.It cooperates with UBE2D2 to ubiquitinate USP4, IKBKB and itself, and binds to SCF E3 ligase to mediate ubiquitination of CDKN1B.TRIM21 Protein, Mouse (His-SUMO) is the recombinant mouse-derived TRIM21 protein, expressed by E.coli , with N-His, N-SUMO labeled tag.

Background

TRIM21 Protein functions as an E3 ubiquitin-protein ligase, relying on E2 enzymes (UBE2D1, UBE2D2, UBE2E1, UBE2E2). It forms a ubiquitin ligase complex with UBE2D2, ubiquitinating USP4, IKBKB, and itself. Associated with cullin-RING-based SCF E3 ligase complexes, it mediates CDKN1B ubiquitination and participates in the negative regulation of Tax-induced NF-kappa-B signaling. TRIM21 negatively regulates IFN-beta production and mediates ubiquitin-mediated degradation of IgG1 heavy chain. It promotes IRF8 ubiquitination, influences cell cycle progression, enhances DCP2 decapping activity, and plays a role in autophagy regulation. Additionally, TRIM21 is involved in innate immunity, inflammatory responses, and antiviral defense, mediating ubiquitination events that impact cellular processes.

Species

Mouse

Source

E. coli

Tag

N-His;N-SUMO

Accession

Q62191 (1M-470M)

Gene ID
Molecular Construction
N-term
6*His-SUMO
TRIM21 (1M-470M)
Accession # Q62191
C-term
Synonyms
Trim21; Ro52; Ssa1; E3 ubiquitin-protein ligase TRIM21; EC 2.3.2.27; 52kDa Ro protein; 52kDa ribonucleoprotein autoantigen Ro/SS-A; RING-type E3 ubiquitin transferase TRIM21; Ro(SS-A); Sjoegren syndrome type A antigen; SS-A; Tripartite motif-containing protein 21
AA Sequence

MSPSTTSKMSLEKMWEEVTCSICLDPMVEPMSIECGHCFCKECIFEVGKNGGSSCPECRQQFLLRNLRPNRHIANMVENLKQIAQNTKKSTQETHCMKHGEKLHLFCEEDGQALCWVCAQSGKHRDHTRVPIEEAAKVYQEKIHVVLEKLRKGKELAEKMEMDLTMQRTDWKRNIDTQKSRIHAEFALQNSLLAQEEQRQLQRLEKDQREYLRLLGKKEAELAEKNQALQELISELERRIRGSELELLQEVRIILERSGSWNLDTLDIDAPDLTSTCPVPGRKKMLRTCWVHITLDRNTANSWLIISKDRRQVRMGDTHQNVSDNKERFSNYPMVLGAQRFSSGKMYWEVDVTQKEAWDLGVCRDSVQRKGQFSLSPENGFWTIWLWQDSYEAGTSPQTTLHIQVPPCQIGIFVDYEAGVVSFYNITDHGSLIYTFSECVFAGPLRPFFNVGFNYSGGNAAPLKLCPLKM

Molecular Weight

Approximately 70.2 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against solution in 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TRIM21 Protein, Mouse (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TRIM21 Protein, Mouse (His-SUMO)
Cat. No.:
HY-P71570
Quantity:
MCE Japan Authorized Agent: