TrkA Protein, Canine (HEK293, His)

TrkA Protein (isoform 3) belongs to the nerve growth factor receptor family and can promote angiogenesis and has carcinogenic activity when overexpressed. TrkA Protein (isoform 3) antagonizes the anti-proliferative NGF-NTRK1 signaling that promotes the differentiation of neuronal precursors. TrkA Protein, Canine (HEK293, His) is the recombinant canine-derived TrkA protein, expressed by HEK293 , with N-His labeled tag.

TrkA Protein (isoform 3) is only expressed in undifferentiated early neural progenitor cells, human neuroblastoma (NBs), and other subsets of neural crest-derived tumors, and can promote angiogenesis and exhibit carcinogenic activity when overexpressed. TrkA Protein (isoform 3) antagonizes the anti-proliferative NGF-NTRK1 signaling that promotes the differentiation of neuronal precursors^[1].

Measured by its ability to inhibit NGF-induced proliferation of TF-1 human erythroleukemic cells. The ED₅₀ for this effect is 1.122 μg/mL in the presence of 10 ng/mL of NGF (HY-P7660), corresponding to a specific activity is 891.2656 U/mg.

Canine

HEK293

N-6*His

A0A8I3P078/XP_851619.3 (P285-K410)

490404  [NCBI]

PASVQLHEAVELHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPVANETVRHGCLRLNQPTHVNNGNYTLLAANPSGRAAAFVMAAFMDNPFEFNPEDPIPVSFSPVDTNSTSGDPVEK

Approximately 20-42 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween80.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.