1. Recombinant Proteins
  2. CAR-T Related Proteins
  3. TROP-2
  4. TROP-2 Protein, Rat (246a.a, HEK293, His)

The TROP-2 protein serves as a growth factor receptor and plays a key role in mediating cellular responses related to growth regulation. This implies its importance in transducing signals that influence cell growth processes. TROP-2 Protein, Rat (246a.a, HEK293, His) is the recombinant rat-derived TROP-2 protein, expressed by HEK293 , with C-His labeled tag. The total length of TROP-2 Protein, Rat (246a.a, HEK293, His) is 246 a.a., with molecular weight of 35-50 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg USD 61 In-stock
10 μg USD 97 In-stock
50 μg USD 252 In-stock
100 μg USD 404 In-stock
500 μg USD 1208 In-stock
1 mg USD 1943 In-stock
> 1 mg   Get quote  

Get it February 25 by noon. Order within 18 hrs 16 mins.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The TROP-2 protein serves as a growth factor receptor and plays a key role in mediating cellular responses related to growth regulation. This implies its importance in transducing signals that influence cell growth processes. TROP-2 Protein, Rat (246a.a, HEK293, His) is the recombinant rat-derived TROP-2 protein, expressed by HEK293 , with C-His labeled tag. The total length of TROP-2 Protein, Rat (246a.a, HEK293, His) is 246 a.a., with molecular weight of 35-50 kDa.

Background

The TROP-2 protein appears to serve as a growth factor receptor, implying a pivotal role in mediating cellular responses related to growth regulation. This suggests that TROP-2 is integral to the transduction of signals that influence cellular growth processes. A more in-depth exploration of the specific signaling pathways and downstream effects orchestrated by TROP-2 in its capacity as a growth factor receptor could yield valuable insights into its functional significance, shedding light on potential implications for cellular development and homeostasis.

Species

Rat

Source

HEK293

Tag

C-His

Accession

Q6P9Z6 (Q25-G270)

Gene ID
Molecular Construction
N-term
TROP-2 (Q25-G270)
Accession # Q6P9Z6
His
C-term
Synonyms
EGP1; EGP-1; TROP2; GA733-1; gp50; T16; TACSTD2; TROP-2; M1S1; TACD2
AA Sequence

QINCTCPTNKMTICNSNGPGGVCQCRAIGSQVLVDCSTLTSKCLLLKARMSARKSSRRLVNPSEHAILDNDGLYDPECDDKGRFKARQCNQTSVCWCVNSVGVRRTDKGDQSLRCDEVVRTHHILIELRHRPTDRAFNHSDLDSELRRLFKERYKLHPSFLAAVHYEEPTIQIELQQNASQKGLRDVDIADAAYYFERDIKGESLFVGRRGLDVQVRGEPLHVERTLIYYLDEKPPQFSMKRLTTG

Molecular Weight

Approximately 35-50 kDa due to the glycosylation.

Purity

Greater than 95% as determined by Tris-Bis PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TROP-2 Protein, Rat (246a.a, HEK293, His) Related Classifications

Help & FAQs
  • How should lyophilized recombinant proteins be reconstituted and stored?

    1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss. 2. Taking 10 μg as an example, first add 20 μL of reconstituted solution provided by MCE and use a pipette to gently resuspend the lyophilized protein until it is fully dissolved.. (For most proteins, the reconstitution solution we provide is sterile water. If a diluent other than water is required, it will be indicated in the product's Certificate of Analysis (COA).). 3. Add an additional 80 μL of buffer/culture medium containing carrier protein (either 0.1% BSA, 5% HSA, 10% FBS, or 5% trehalose), and then use a pipette to gently mix until uniform. The final concentration is should not be lower than 100 μg/mL. 4. Aliquot at least 20 μL per tube. 5. After aliquoting, store it frozen at a temperature ranging from -20ºC to -80ºC, and it can be preserved for 3 to 6 months.

  • How should solution-form recombinant proteins be stored?

    1. The product can be stored in its original form and diluted as needed upon use. 2. Alternatively, dilute with a buffer/culture medium containing a carrier protein (either 0.1% BSA, 5% HSA, 10% FBS, or 5% alginate), mix well by pipetting, and ensure that

  • Why is it necessary to add carrier proteins?

    Carrier proteins are commonly added to enhance the stability of recombinant proteins, preventing them from adhering to the walls of the container during freezing or thawing processes. Plastic tubes have a certain adsorptive capacity for proteins, which may lead to difficulty in separating the protein from the tube walls, resulting in a decrease in the actual concentration of the protein in the solution and thus affecting its activity. To minimize such losses, it is recommended to add a commonly used carrier protein solution prior to the long-term storage of recombinant protein products.

  • Carrier protein types and options?

    In cases where the carrier protein is not expected to influence the experimental outcomes, an appropriate carrier protein, such as 0.1% BSA (Bovine Serum Albumin), 5% HSA (Human Serum Albumin), 10% FBS (Fetal Bovine Serum), or 5% trehalose, can be incorpo

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TROP-2 Protein, Rat (246a.a, HEK293, His)
Cat. No.:
HY-P78364
Quantity:
MCE Japan Authorized Agent: