TROP-2 Protein, Rat (246a.a, HEK293, His)

The TROP-2 protein serves as a growth factor receptor and plays a key role in mediating cellular responses related to growth regulation. This implies its importance in transducing signals that influence cell growth processes. TROP-2 Protein, Rat (246a.a, HEK293, His) is the recombinant rat-derived TROP-2 protein, expressed by HEK293 , with C-His labeled tag. The total length of TROP-2 Protein, Rat (246a.a, HEK293, His) is 246 a.a., with molecular weight of 35-50 kDa.

The TROP-2 protein appears to serve as a growth factor receptor, implying a pivotal role in mediating cellular responses related to growth regulation. This suggests that TROP-2 is integral to the transduction of signals that influence cellular growth processes. A more in-depth exploration of the specific signaling pathways and downstream effects orchestrated by TROP-2 in its capacity as a growth factor receptor could yield valuable insights into its functional significance, shedding light on potential implications for cellular development and homeostasis.

Rat

HEK293

C-His

Q6P9Z6 (Q25-G270)

494343  [NCBI]

QINCTCPTNKMTICNSNGPGGVCQCRAIGSQVLVDCSTLTSKCLLLKARMSARKSSRRLVNPSEHAILDNDGLYDPECDDKGRFKARQCNQTSVCWCVNSVGVRRTDKGDQSLRCDEVVRTHHILIELRHRPTDRAFNHSDLDSELRRLFKERYKLHPSFLAAVHYEEPTIQIELQQNASQKGLRDVDIADAAYYFERDIKGESLFVGRRGLDVQVRGEPLHVERTLIYYLDEKPPQFSMKRLTTG

Approximately 35-50 kDa due to the glycosylation.

Greater than 95% as determined by Tris-Bis PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.