1. Recombinant Proteins
  2. CAR-T Related Proteins
  3. TROP-2
  4. TROP-2 Protein, Rhesus macaque (HEK293, His)

Tumor associated calcium signal transducer 2 (TACSTD2) is a carcinoma-associated antigen which is a cell surface receptor that transduces calcium signals and may also function as a growth factor receptor. TACSTD2 is involved in negative regulation of branching involved in ureteric bud morphogenesis; negative regulation of cellular component organization; negative regulation of substrate adhesion-dependent cell spreading; positive regulation of stem cell differentiation; and regulation of epithelial cell proliferation. TROP-2 Protein, Rhesus macaque (HEK293, His) is the recombinant Rhesus Macaque-derived TROP-2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of TROP-2 Protein, Rhesus macaque (HEK293, His) is 246 a.a., with molecular weight of 38-45 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Tumor associated calcium signal transducer 2 (TACSTD2) is a carcinoma-associated antigen which is a cell surface receptor that transduces calcium signals and may also function as a growth factor receptor. TACSTD2 is involved in negative regulation of branching involved in ureteric bud morphogenesis; negative regulation of cellular component organization; negative regulation of substrate adhesion-dependent cell spreading; positive regulation of stem cell differentiation; and regulation of epithelial cell proliferation. TROP-2 Protein, Rhesus macaque (HEK293, His) is the recombinant Rhesus Macaque-derived TROP-2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of TROP-2 Protein, Rhesus macaque (HEK293, His) is 246 a.a., with molecular weight of 38-45 kDa.

Background

Tumor associated calcium signal transducer 2 (TACSTD2) is a carcinoma-associated antigen which is a cell surface receptor that transduces calcium signals. Mutations of TACSTD2 have been associated with gelatinous drop-like corneal dystrophy. TACSTD2 may also function as a growth factor receptor. TACSTD2 is involved in several processes, including negative regulation of branching involved in ureteric bud morphogenesis; negative regulation of cellular component organization; negative regulation of substrate adhesion-dependent cell spreading; positive regulation of stem cell differentiation; and regulation of epithelial cell proliferation. TACSTD2 is located in several cellular components, including basal plasma membrane; extracellular space; and lateral plasma membrane.

Species

Rhesus Macaque

Source

HEK293

Tag

C-6*His

Accession

XP_001114599.1 (H27-R272)

Gene ID
Molecular Construction
N-term
TROP-2 (H27-R272)
Accession # XP_001114599.1
6*His
C-term
Synonyms
Tumor-associated calcium signal transducer 2; Membrane component chromosome 1 surfacemarker 1; Cell surface glycoprotein Trop-2; TACSTD2; TROP2
AA Sequence

HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGVAVDCSTLTSKCLLLKARMSAPKNARTLVRPNEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDVKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKR

Molecular Weight

38-45 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

TROP-2 Protein, Rhesus macaque (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TROP-2 Protein, Rhesus macaque (HEK293, His)
Cat. No.:
HY-P71388
Quantity:
MCE Japan Authorized Agent: