TROP-2 Protein, Rhesus macaque (HEK293, His)

Tumor associated calcium signal transducer 2 (TACSTD2) is a carcinoma-associated antigen which is a cell surface receptor that transduces calcium signals and may also function as a growth factor receptor. TACSTD2 is involved in negative regulation of branching involved in ureteric bud morphogenesis; negative regulation of cellular component organization; negative regulation of substrate adhesion-dependent cell spreading; positive regulation of stem cell differentiation; and regulation of epithelial cell proliferation. TROP-2 Protein, Rhesus macaque (HEK293, His) is the recombinant Rhesus Macaque-derived TROP-2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of TROP-2 Protein, Rhesus macaque (HEK293, His) is 246 a.a., with molecular weight of 38-45 kDa.

Tumor associated calcium signal transducer 2 (TACSTD2) is a carcinoma-associated antigen which is a cell surface receptor that transduces calcium signals. Mutations of TACSTD2 have been associated with gelatinous drop-like corneal dystrophy. TACSTD2 may also function as a growth factor receptor. TACSTD2 is involved in several processes, including negative regulation of branching involved in ureteric bud morphogenesis; negative regulation of cellular component organization; negative regulation of substrate adhesion-dependent cell spreading; positive regulation of stem cell differentiation; and regulation of epithelial cell proliferation. TACSTD2 is located in several cellular components, including basal plasma membrane; extracellular space; and lateral plasma membrane.

Rhesus Macaque

HEK293

C-6*His

XP_001114599.1 (H27-R272)

716334  [NCBI]

HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGVAVDCSTLTSKCLLLKARMSAPKNARTLVRPNEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDVKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKR

38-45 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.