Troponin C/TNNC1 Protein, Human (N-His)

Troponin C, represented by the TNNC1 gene, centrally regulates striated muscle contraction. In the troponin complex consisting of Tn-I, Tn-T, and Tn-C, Tn-I inhibits the actomyosin ATPase, while Tn-T binds to tropomyosin. Troponin C/TNNC1 Protein, Human (N-His) is the recombinant human-derived Troponin C/TNNC1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of Troponin C/TNNC1 Protein, Human (N-His) is 161 a.a., with molecular weight of approximately 19 kDa.

Troponin C, represented by the TNNC1 gene, serves as the central regulatory protein orchestrating striated muscle contraction. The troponin complex, composed of Tn-I, Tn-T, and Tn-C, plays a pivotal role in this regulatory mechanism. Tn-I functions as the inhibitor of actomyosin ATPase, while Tn-T provides the binding site for tropomyosin. Of particular significance, Tn-C serves as the calcium-binding component, and upon calcium interaction, it nullifies the inhibitory effect of Tn-I on actin filaments. This intricate interplay highlights the pivotal role of Troponin C in translating calcium signals into the modulation of muscle contraction dynamics.

Human

E. coli

N-6*His

P63316 (M1-E161)

7134  [NCBI]

MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

approximately 19 kDa

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.