1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TNF Superfamily
  4. TNF Receptor Superfamily
  5. TROY Protein
  6. TROY/TNFRSF19 Protein, Mouse (HEK293, His)

TROY Protein also known as TAJ, TNFRSF19, a type I transmembrane receptor, is a member of the TNF receptor superfamily. TROY Protein is involved in embryonic development and the development of skin and hair follicles. TROY Protein inhibits cell proliferation in vitro and shows antitumor activity in xenografted models. TROY/TNFRSF19 Protein, Mouse (HEK293, His) is a recombinant protein with a C-Terminal His label, It consists of 170 amino acids (M1-L170) and is produced in HEK293 cells.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

TROY Protein also known as TAJ, TNFRSF19, a type I transmembrane receptor, is a member of the TNF receptor superfamily. TROY Protein is involved in embryonic development and the development of skin and hair follicles[1]. TROY Protein inhibits cell proliferation in vitro and shows antitumor activity in xenografted models[2]. TROY/TNFRSF19 Protein, Mouse (HEK293, His) is a recombinant protein with a C-Terminal His label, It consists of 170 amino acids (M1-L170) and is produced in HEK293 cells.

Background

TROY Protein shows a unique tissue distribution in the embryo as well as after birth; in the embryo, TROY is exclusively expressed in the epithelium including the neuroepithelium, skin, bronchiolar epithelium, conjunctiva, and so forth, whereas after birth, TROY Protein is strongly expressed in hair follicles like Edar as well as in neurons[1]. TROY Protein is expressed in several invasive cancers, including colorectal cancer, lung cancer, melanoma, nasopharyngeal carcinoma, prostate cancer and GBM[3].
The amino acid sequence of human TROY protein has low homology for mouse TROY protein.
TROY Protein is a growth-promoting signaling molecule that also regulates the NF-κB pathway via interacting with RKIP[2]. In addition, increased TROY expression promotes STAT3 phosphorylation and STAT3 transcriptional activity that is dependent upon JAK1[3]. TROY interacts with LGR5 and inhibits Wnt signaling[4].
Knock-down of TROY suppresses the growth of glioma cells and induces cell cycle arrest at the G1-S phase in U87 cells, significantly decreasing NF-kB luciferase activity[2]. Increased TROY expression increases JAK1 phosphorylation, and silencing TROY expression inhibits GBM cell invasion, and increases sensitivity to temozolomide in glioblastoma[3].

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Human Lgr5/GPR49, at 2 μg/mL (100 μL/well) can bind TNFRSF19. The KD for this effect is 173.6 nM.

  • Measured by its binding ability in a functional ELISA. Immobilized Human Lgr5/GPR49, at 2 μg/mL (100 μL/well) can bind TNFRSF19. The KD for this effect is 173.6 nM.
Species

Mouse

Source

HEK293

Tag

C-His

Accession

Q9JLL3 (E30-L170)

Gene ID
Molecular Construction
N-term
TROY (E30-L170)
Accession # Q9JLL3
His
C-term
Synonyms
Tumor necrosis factor receptor superfamily member 19; TRADE; TNFRSF19; TROY
AA Sequence

ETGDCRQQEFKDRSGNCVLCKQCGPGMELSKECGFGYGEDAQCVPCRPHRFKEDWGFQKCKPCADCALVNRFQRANCSHTSDAVCGDCLPGFYRKTKLVGFQDMECVPCGDPPPPYEPHCTSKVNLVKISSTVSSPRDTAL

Molecular Weight

Approximately 25-30 kDa due to the glycosylation

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

TROY/TNFRSF19 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TROY/TNFRSF19 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P73570
Quantity:
MCE Japan Authorized Agent: