PRSS3/Trypsin-3 Protein, Human (His)

PRSS3/Trypsin-3 is a digestive protease with specific substrate preference that cleaves proteins after Arg residues. This enzymatic activity is combined with its ability to exhibit proteolytic effects on Kunitz-type trypsin inhibitors. PRSS3/Trypsin-3 Protein, Human (His) is the recombinant human-derived PRSS3/Trypsin-3 protein, expressed by E. coli , with N-6*His labeled tag. The total length of PRSS3/Trypsin-3 Protein, Human (His) is 223 a.a., with molecular weight of ~28.2 kDa.

PRSS3, also known as Trypsin-3, is a digestive protease with a distinct substrate specificity, as it cleaves proteins preferentially after an Arginine residue. This trypsin-like enzyme plays a crucial role in the digestive process by breaking down dietary proteins into smaller peptides. Notably, PRSS3 exhibits proteolytic activity towards Kunitz-type trypsin inhibitors, suggesting its involvement in regulatory interactions with endogenous protease inhibitors. The enzyme's ability to cleave proteins at specific sites underscores its importance in protein digestion, and its interactions with trypsin inhibitors highlight its role in the intricate balance of protease activity within cellular environments. Ongoing research may reveal further insights into the physiological implications and regulatory functions of PRSS3 in digestive physiology.

Human

E. coli

N-6*His

P35030 (I81-N303)

5646  [NCBI]

IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTTPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAAN

Approximately 28.2 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in PBS, 6% Trehalose, pH 7.4 or 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.