TSLP Protein, Cynomolgus (His)

Thymic stromal lymphopoietin (TSLP) is a hemopoietic cytokine proposed to signal through a heterodimeric receptor complex composed of the thymic stromal lymphopoietin receptor and the IL-7R alpha chain. TSLP mainly impacts myeloid cells and promotes T helper type 2 (TH2) cell responses associated with immunity in various inflammatory diseases, including asthma, allergic inflammation and chronic obstructive pulmonary disease. TSLP Protein, Cynomolgus (His) is the recombinant cynomolgus-derived TSLP protein, expressed by E. coli , with C-6*His labeled tag and Q37E mutation. The total length of TSLP Protein, Cynomolgus (His) is 131 a.a., with molecular weight of ~16.0 kDa.

Thymic stromal lymphopoietin (TSLP) is a hemopoietic cytokine proposed to signal through a heterodimeric receptor complex composed of the thymic stromal lymphopoietin receptor and the IL-7R alpha chain. TSLP mainly impacts myeloid cells and induces the release of T cell-attracting chemokines from monocytes and enhances the maturation of CD11c(+) dendritic cells. TSLP promotes T helper type 2 (TH2) cell responses that are associated with immunity in various inflammatory diseases, including asthma, allergic inflammation and chronic obstructive pulmonary disease, therefore TSLP is considered a potential therapeutic target for the treatment of such diseases. Alternative splicing of TSLP gene results in multiple isoforms, the shorter (predominant) isoform is an antimicrobial protein, displaying antibacterial and antifungal activity against B. cereus, E. coli, E. faecalis, S. mitis, S. epidermidis, and C. albicans^[1][2][3][4].

Cynomolgus

E. coli

C-6*His

XP_005557555.1 (Y29-Q159, Q37E)

102119254  [NCBI]

YDFTNCDFEKIEADYLRTISKDLITYMSGTKSTDFNNTVSCSNRPHCLTEIQSLTFNPTPRCASLAKEMFARKTKATLALWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLLGLWRRFIRTLLKKQ

Approximately 16.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.