TSLP R Protein, Human (HEK293, Fc)

TSLP R Protein, a receptor for TSLP, forms a functional complex with IL7R, activating STAT3 and STAT5 for cell proliferation. It also activates JAK2, aiding in hematopoietic system development. TSLP R forms a heterodimer with CRLF2 and IL7R, highlighting its role in intricate signaling pathways crucial for cellular responses and hematopoietic development. TSLP R Protein, Human (HEK293, Fc) is the recombinant human-derived TSLP R protein, expressed by HEK293 , with C-hFc labeled tag. The total length of TSLP R Protein, Human (HEK293, Fc) is 207 a.a., with molecular weight of 60-80 kDa.

The TSLP R Protein serves as the receptor for thymic stromal lymphopoietin (TSLP) and, in conjunction with IL7R, forms a functional complex capable of stimulating cell proliferation through the activation of STAT3 and STAT5. Additionally, the receptor activates JAK2, contributing to the development of the hematopoietic system. The TSLP R Protein forms a heterodimer with CRLF2 and IL7R, indicating its involvement in intricate signaling pathways critical for cellular responses and hematopoietic development.

Human

HEK293

C-hFc

Q9HC73 (G25-K231)

64109  [NCBI]

GAAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHYRFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPSSPKHVRFSWHQDAVTVTCSDLSYGDLLYEVQYRSPFDTEWQSKQENTCNVTIEGLDAEKCYSFWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSK

60-80 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.