1. Recombinant Proteins
  2. Receptor Proteins
  3. TSLP R Protein, Human (HEK293, Fc)

TSLP R Protein, Human (HEK293, Fc)

Cat. No.: HY-P70794
COA Handling Instructions

TSLP R Protein, a receptor for TSLP, forms a functional complex with IL7R, activating STAT3 and STAT5 for cell proliferation. It also activates JAK2, aiding in hematopoietic system development. TSLP R forms a heterodimer with CRLF2 and IL7R, highlighting its role in intricate signaling pathways crucial for cellular responses and hematopoietic development. TSLP R Protein, Human (HEK293, Fc) is the recombinant human-derived TSLP R protein, expressed by HEK293 , with C-hFc labeled tag. The total length of TSLP R Protein, Human (HEK293, Fc) is 207 a.a., with molecular weight of 60-80 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg $80 In-stock
50 μg $240 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TSLP R Protein, a receptor for TSLP, forms a functional complex with IL7R, activating STAT3 and STAT5 for cell proliferation. It also activates JAK2, aiding in hematopoietic system development. TSLP R forms a heterodimer with CRLF2 and IL7R, highlighting its role in intricate signaling pathways crucial for cellular responses and hematopoietic development. TSLP R Protein, Human (HEK293, Fc) is the recombinant human-derived TSLP R protein, expressed by HEK293 , with C-hFc labeled tag. The total length of TSLP R Protein, Human (HEK293, Fc) is 207 a.a., with molecular weight of 60-80 kDa.

Background

The TSLP R Protein serves as the receptor for thymic stromal lymphopoietin (TSLP) and, in conjunction with IL7R, forms a functional complex capable of stimulating cell proliferation through the activation of STAT3 and STAT5. Additionally, the receptor activates JAK2, contributing to the development of the hematopoietic system. The TSLP R Protein forms a heterodimer with CRLF2 and IL7R, indicating its involvement in intricate signaling pathways critical for cellular responses and hematopoietic development.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q9HC73 (G25-K231)

Gene ID
Molecular Construction
N-term
TSLP R (G25-K231)
Accession # Q9HC73
hFc
C-term
Synonyms
CRL2; CRL2cytokine receptor CRL2 precusor; CRLF2; CRLF2Y; CRLM-2; Cytokine receptor-like 2; cytokine receptor-like factor 2; ILXR; IL-XR; P2RY8/CRLF2 fusion; PCOR1; TSLP R; TSLP receptor; TSLPR
AA Sequence

GAAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHYRFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPSSPKHVRFSWHQDAVTVTCSDLSYGDLLYEVQYRSPFDTEWQSKQENTCNVTIEGLDAEKCYSFWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSK

Molecular Weight

60-80 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

TSLP R Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TSLP R Protein, Human (HEK293, Fc)
Cat. No.:
HY-P70794
Quantity:
MCE Japan Authorized Agent: