TSPO Protein, Mouse (Cell-Free, His)

The TSPO protein was originally thought to be a peripheral benzodiazepine receptor that binds protoporphyrin IX and isoquinoline carboxamide. TSPO Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived TSPO protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of TSPO Protein, Mouse (Cell-Free, His) is 169 a.a., with molecular weight of 21.7 kDa.

TSPO (Translocator Protein) exhibits the ability to bind protoporphyrin IX, suggesting a potential role in the transport of porphyrins and heme. Initially identified as a peripheral-type benzodiazepine receptor, TSPO can also bind isoquinoline carboxamides. Moreover, it plays a role in promoting cholesterol transport across mitochondrial membranes, implicating its involvement in lipid metabolism. Although its precise physiological function is controversial and some reports suggest that it may not be essential for steroid hormone biosynthesis, TSPO interacts with various proteins such as TSPOAP1, MOST-1, and potentially STAR, indicating its participation in diverse cellular processes.

Mouse

E. coli Cell-free

N-10*His

P50637 (M1-E169)

12257

MPESWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIVWKELGGFTEDAMVPLGLYTGQLALNWAWPPIFFGARQMGWALADLLLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATVLNYYVWRDNSGRRGGSRLPE

21.7 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.15 M NaCl, 0.05% Brij-78, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add 5-50% of glycerol (final concentration). Our default final concentration of glycerol is 50%. Customers could use it as reference.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.