1. Recombinant Proteins
  2. Others
  3. Tubulin cofactor A Protein, Human (Tag Free)

The tubulin cofactor A protein is a key tubulin folding protein that initiates the tubulin folding pathway within the supercomplex (cofactors A to E). Cofactors A and D capture tubulin and stabilize it in a quasi-native state. Tubulin cofactor A Protein, Human (Tag Free) is the recombinant human-derived Tubulin cofactor A protein, expressed by E. coli , with tag free. The total length of Tubulin cofactor A Protein, Human (Tag Free) is 108 a.a., with molecular weight of ~14 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The tubulin cofactor A protein is a key tubulin folding protein that initiates the tubulin folding pathway within the supercomplex (cofactors A to E). Cofactors A and D capture tubulin and stabilize it in a quasi-native state. Tubulin cofactor A Protein, Human (Tag Free) is the recombinant human-derived Tubulin cofactor A protein, expressed by E. coli , with tag free. The total length of Tubulin cofactor A Protein, Human (Tag Free) is 108 a.a., with molecular weight of ~14 kDa.

Background

Tubulin cofactor A Protein takes on a crucial role as a tubulin-folding protein, actively participating in the initial stage of the tubulin folding pathway. It is part of a supercomplex composed of cofactors A to E. Cofactors A and D play a pivotal role by capturing and stabilizing tubulin in a quasi-native conformation. The interaction of cofactor E with the cofactor D-tubulin complex facilitates the subsequent binding to cofactor C, leading to the release of tubulin polypeptides committed to adopting the native state. In orchestrating these intricate steps, Tubulin cofactor A Protein emerges as a key player in the early phases of tubulin folding, contributing to the formation of a functional and stable tubulin structure.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

O75347 (M1-A108)

Gene ID
Molecular Construction
N-term
TBCA (M1-A108)
Accession # O75347
C-term
Synonyms
Tubulin-specific chaperone A; CFA; TBCA
AA Sequence

MADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMRAEDGENYDIKKQAEILQESRMMIPDCQRRLEAAYLDLQRILENEKDLEEAEEYKEARLVLDSVKLEA

Molecular Weight

Approximately 14 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Tubulin cofactor A Protein, Human (Tag Free) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Tubulin cofactor A Protein, Human (Tag Free)
Cat. No.:
HY-P73565A
Quantity:
MCE Japan Authorized Agent: