Tubulin cofactor A Protein, Human (Tag Free)

The tubulin cofactor A protein is a key tubulin folding protein that initiates the tubulin folding pathway within the supercomplex (cofactors A to E). Cofactors A and D capture tubulin and stabilize it in a quasi-native state. Tubulin cofactor A Protein, Human (Tag Free) is the recombinant human-derived Tubulin cofactor A protein, expressed by E. coli , with tag free. The total length of Tubulin cofactor A Protein, Human (Tag Free) is 108 a.a., with molecular weight of ~14 kDa.

Tubulin cofactor A Protein takes on a crucial role as a tubulin-folding protein, actively participating in the initial stage of the tubulin folding pathway. It is part of a supercomplex composed of cofactors A to E. Cofactors A and D play a pivotal role by capturing and stabilizing tubulin in a quasi-native conformation. The interaction of cofactor E with the cofactor D-tubulin complex facilitates the subsequent binding to cofactor C, leading to the release of tubulin polypeptides committed to adopting the native state. In orchestrating these intricate steps, Tubulin cofactor A Protein emerges as a key player in the early phases of tubulin folding, contributing to the formation of a functional and stable tubulin structure.

Human

E. coli

Tag Free

O75347 (M1-A108)

6902  [NCBI]

MADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMRAEDGENYDIKKQAEILQESRMMIPDCQRRLEAAYLDLQRILENEKDLEEAEEYKEARLVLDSVKLEA

Approximately 14 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.