1. Recombinant Proteins
  2. Ubiquitin Related Proteins
  3. Ubiquitin Enzymes
  4. E2 Enzymes
  5. Ubiquitin-Conjugating Enzyme E2 D1
  6. UBE2D1 Protein, Human (GST)

UBE2D1 Protein, crucial in cellular processes, accepts ubiquitin from the E1 complex, preferentially catalyzing 'Lys-48'-linked polyubiquitination in vitro, showcasing versatility. It mediates selective degradation of short-lived and aberrant proteins and participates in E6/E6-AP-induced p53/TP53 ubiquitination. UBE2D1 facilitates ubiquitination of PEX5 and auto-ubiquitination of STUB1, TRAF6, and TRIM63/MURF1. It ubiquitinates STUB1-associated HSP90AB1 in vitro, highlighting involvement in cellular pathways. Lacking inherent specificity for any ubiquitin lysine residue, UBE2D1's dynamic nature in ubiquitin modification processes is notable. Its essential role in viral activation of IRF3 and mediation of CYP3A4 polyubiquitination emphasizes multifaceted contributions to cellular function. UBE2D1 Protein, Human (GST) is the recombinant human-derived UBE2D1 protein, expressed by E. coli, with N-GST labeled tag. The total length of UBE2D1 Protein, Human (GST) is 147 a.a., with molecular weight of ~40.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

UBE2D1 Protein, crucial in cellular processes, accepts ubiquitin from the E1 complex, preferentially catalyzing 'Lys-48'-linked polyubiquitination in vitro, showcasing versatility. It mediates selective degradation of short-lived and aberrant proteins and participates in E6/E6-AP-induced p53/TP53 ubiquitination. UBE2D1 facilitates ubiquitination of PEX5 and auto-ubiquitination of STUB1, TRAF6, and TRIM63/MURF1. It ubiquitinates STUB1-associated HSP90AB1 in vitro, highlighting involvement in cellular pathways. Lacking inherent specificity for any ubiquitin lysine residue, UBE2D1's dynamic nature in ubiquitin modification processes is notable. Its essential role in viral activation of IRF3 and mediation of CYP3A4 polyubiquitination emphasizes multifaceted contributions to cellular function. UBE2D1 Protein, Human (GST) is the recombinant human-derived UBE2D1 protein, expressed by E. coli, with N-GST labeled tag. The total length of UBE2D1 Protein, Human (GST) is 147 a.a., with molecular weight of ~40.0 kDa.

Background

The UBE2D1 protein plays a pivotal role in cellular processes by accepting ubiquitin from the E1 complex and facilitating its covalent attachment to diverse proteins (source). In vitro, UBE2D1 demonstrates a catalytic preference for 'Lys-48'-linked polyubiquitination, showcasing its versatility in modifying target proteins (source). Functioning as a key mediator in the selective degradation of short-lived and aberrant proteins, UBE2D1 also participates in the E6/E6-AP-induced ubiquitination of p53/TP53. Moreover, it facilitates the ubiquitination of PEX5 and orchestrates the auto-ubiquitination of STUB1, TRAF6, and TRIM63/MURF1 (sources). UBE2D1 exhibits the capability to ubiquitinate STUB1-associated HSP90AB1 in vitro, underscoring its involvement in intricate cellular pathways (source). Notably, UBE2D1 lacks inherent specificity for any particular lysine residue of ubiquitin, highlighting its dynamic nature in ubiquitin modification processes (source). Its essential role in viral activation of IRF3 and mediation of the polyubiquitination of CYP3A4 further emphasizes UBE2D1's multifaceted contributions to cellular function (sources).

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

N-GST

Accession

P51668 (M1-M147)

Gene ID
Molecular Construction
N-term
GST
UBE2D1 (M1-M147)
Accession # P51668
C-term
Synonyms
Ubiquitin-conjugating enzyme E2 D1; Stimulator of Fe transport; SFT; UBC4/5 homolog; UbcH5; Ubiquitin carrier protein D1; Ubiquitin-conjugating enzyme E2(17)KB 1; Ubiquitin-conjugating enzyme E2-17 kDa 1; Ubiquitin-protein ligase D1; SFT; UBC5A; UBCH5; UBCH5A
AA Sequence

MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM

Molecular Weight

Approximately 40.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 50 mM HEPES, 150 mM NaCl, 2 mM DTT, 10% Glycerin, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
UBE2D1 Protein, Human (GST)
Cat. No.:
HY-P71399
Quantity:
MCE Japan Authorized Agent: