UBE2G1 Protein, Human

UBE2G1 Protein, a crucial ubiquitin-proteasome system player, acts as an E2 ubiquitin-conjugating enzyme, facilitating ubiquitin attachment to diverse protein substrates. In vitro, UBE2G1 demonstrates catalytic competence in 'Lys-48' and 'Lys-63'-linked polyubiquitination reactions. This multifaceted enzyme is implicated in potential roles, including the degradation of muscle-specific proteins, emphasizing its involvement in cellular processes related to protein turnover. Additionally, UBE2G1 mediates the polyubiquitination of CYP3A4, a cytochrome P450 enzyme, underscoring its significance in regulating specific cellular pathways. UBE2G1 Protein, Human is the recombinant human-derived UBE2G1 protein, expressed by E. coli, with tag free. The total length of UBE2G1 Protein, Human is 170 a.a., with molecular weight of ~19.5 kDa.

UBE2G1, an essential player in the ubiquitin-proteasome system, serves as an E2 ubiquitin-conjugating enzyme, facilitating the covalent attachment of ubiquitin to diverse protein substrates. In vitro, UBE2G1 showcases its catalytic competence by catalyzing both 'Lys-48'- and 'Lys-63'-linked polyubiquitination reactions. This multifaceted enzyme is implicated in potential roles, including the degradation of muscle-specific proteins, highlighting its involvement in cellular processes related to protein turnover. Additionally, UBE2G1 demonstrates its functional relevance by mediating the polyubiquitination of CYP3A4, a cytochrome P450 enzyme involved in the metabolism of various substrates, underscoring its significance in regulating specific cellular pathways.

Under ATP and E1 conditions, E2 covalently binds with ubiquitin molecules to form thioester complexes E2~Ub.

Human

E. coli

Tag Free

P62253 (M1-E170)

7326  [NCBI]

MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQETAFE

Approximately 19.5 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, 10% Glycerol, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.