UBE2G2 Protein, Human (GST)

UBE2G2 Protein, a vital ubiquitination component, accepts ubiquitin from the E1 complex, catalyzing its covalent attachment to various proteins, with a preference for 'Lys-48'-linked polyubiquitination. Its specificity in shaping ubiquitin chains underscores its role in cellular processes. Intricately associated with endoplasmic reticulum-associated degradation (ERAD), UBE2G2 maintains cellular homeostasis by regulating protein turnover. Indispensable for sterol-induced ubiquitination of 3-hydroxy-3-methylglutaryl coenzyme A reductase, it facilitates subsequent proteasomal degradation. UBE2G2 Protein, Human (GST) is the recombinant human-derived UBE2G2 protein, expressed by E. coli, with N-GST labeled tag. The total length of UBE2G2 Protein, Human (GST) is 165 a.a., with molecular weight of ~43.0 kDa.

UBE2G2, a crucial component in the ubiquitination machinery, plays a pivotal role in the cellular process by accepting ubiquitin from the E1 complex and catalyzing its covalent attachment to various proteins. In vitro, UBE2G2 demonstrates a specific catalytic preference for 'Lys-48'-linked polyubiquitination, highlighting its involvement in shaping ubiquitin chains with specific linkages. Notably, UBE2G2 is intricately associated with endoplasmic reticulum-associated degradation (ERAD), underlining its significance in maintaining cellular homeostasis by regulating protein turnover. Furthermore, UBE2G2 is indispensable for sterol-induced ubiquitination of 3-hydroxy-3-methylglutaryl coenzyme A reductase, facilitating its subsequent proteasomal degradation.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

N-GST

P60604 (M1-L165)

7327  [NCBI]

MAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQKSLGL

Approximately 43.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 50 mM HEPES, 150 mM NaCl, 2 mM DTT, 10% Glycerol, pH 7.5.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.