1. Recombinant Proteins
  2. Ubiquitin Related Proteins
  3. Ubiquitin Enzymes
  4. E2 Enzymes
  5. Ubiquitin Conjugating Enzyme E2 G2
  6. UBE2G2 Protein, Human (GST)

UBE2G2 Protein, a vital ubiquitination component, accepts ubiquitin from the E1 complex, catalyzing its covalent attachment to various proteins, with a preference for 'Lys-48'-linked polyubiquitination. Its specificity in shaping ubiquitin chains underscores its role in cellular processes. Intricately associated with endoplasmic reticulum-associated degradation (ERAD), UBE2G2 maintains cellular homeostasis by regulating protein turnover. Indispensable for sterol-induced ubiquitination of 3-hydroxy-3-methylglutaryl coenzyme A reductase, it facilitates subsequent proteasomal degradation. UBE2G2 Protein, Human (GST) is the recombinant human-derived UBE2G2 protein, expressed by E. coli, with N-GST labeled tag. The total length of UBE2G2 Protein, Human (GST) is 165 a.a., with molecular weight of ~43.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

UBE2G2 Protein, a vital ubiquitination component, accepts ubiquitin from the E1 complex, catalyzing its covalent attachment to various proteins, with a preference for 'Lys-48'-linked polyubiquitination. Its specificity in shaping ubiquitin chains underscores its role in cellular processes. Intricately associated with endoplasmic reticulum-associated degradation (ERAD), UBE2G2 maintains cellular homeostasis by regulating protein turnover. Indispensable for sterol-induced ubiquitination of 3-hydroxy-3-methylglutaryl coenzyme A reductase, it facilitates subsequent proteasomal degradation. UBE2G2 Protein, Human (GST) is the recombinant human-derived UBE2G2 protein, expressed by E. coli, with N-GST labeled tag. The total length of UBE2G2 Protein, Human (GST) is 165 a.a., with molecular weight of ~43.0 kDa.

Background

UBE2G2, a crucial component in the ubiquitination machinery, plays a pivotal role in the cellular process by accepting ubiquitin from the E1 complex and catalyzing its covalent attachment to various proteins. In vitro, UBE2G2 demonstrates a specific catalytic preference for 'Lys-48'-linked polyubiquitination, highlighting its involvement in shaping ubiquitin chains with specific linkages. Notably, UBE2G2 is intricately associated with endoplasmic reticulum-associated degradation (ERAD), underlining its significance in maintaining cellular homeostasis by regulating protein turnover. Furthermore, UBE2G2 is indispensable for sterol-induced ubiquitination of 3-hydroxy-3-methylglutaryl coenzyme A reductase, facilitating its subsequent proteasomal degradation.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

N-GST

Accession

P60604 (M1-L165)

Gene ID
Molecular Construction
N-term
GST
UBE2G2 (M1-L165)
Accession # P60604
C-term
Synonyms
Ubiquitin-Conjugating Enzyme E2 G2; Ubiquitin Carrier Protein G2; Ubiquitin-Protein Ligase G2; UBE2G2
AA Sequence

MAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQKSLGL

Molecular Weight

Approximately 43.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 50 mM HEPES, 150 mM NaCl, 2 mM DTT, 10% Glycerol, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
UBE2G2 Protein, Human (GST)
Cat. No.:
HY-P71401
Quantity:
MCE Japan Authorized Agent: