1. Recombinant Proteins
  2. Ubiquitin Related Proteins
  3. Ubiquitin Enzymes
  4. E2 Enzymes
  5. Ubiquitin Conjugating Enzyme E2 L6
  6. UBE2L6 Protein, Human (His)

UBE2L6 Protein, Human (His)

Cat. No.: HY-P71020
SDS COA Handling Instructions

The UBE2L6 protein plays a key role in cell regulation by catalyzing the covalent attachment of ubiquitin or ISG15 to other proteins. Notably, it plays a role in E6/E6-AP-induced ubiquitination of p53/TP53, a core process in regulating cellular responses to stress and DNA damage. UBE2L6 Protein, Human (His) is the recombinant human-derived UBE2L6 protein, expressed by E. coli , with C-6*His labeled tag. The total length of UBE2L6 Protein, Human (His) is 153 a.a., with molecular weight of ~17.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The UBE2L6 protein plays a key role in cell regulation by catalyzing the covalent attachment of ubiquitin or ISG15 to other proteins. Notably, it plays a role in E6/E6-AP-induced ubiquitination of p53/TP53, a core process in regulating cellular responses to stress and DNA damage. UBE2L6 Protein, Human (His) is the recombinant human-derived UBE2L6 protein, expressed by E. coli , with C-6*His labeled tag. The total length of UBE2L6 Protein, Human (His) is 153 a.a., with molecular weight of ~17.0 kDa.

Background

UBE2L6, also known as ubiquitin-conjugating enzyme E2L6, is a protein that catalyzes the covalent attachment of ubiquitin or ISG15 to other proteins, a process crucial for the regulation of protein stability and function. Specifically, UBE2L6 plays a role in the E6/E6-AP-induced ubiquitination of p53/TP53, a tumor suppressor protein involved in cell cycle regulation and apoptosis. Additionally, UBE2L6 is implicated in promoting ubiquitination and subsequent proteasomal degradation of FLT3, a receptor tyrosine kinase associated with cell proliferation and differentiation. Through these ubiquitination events, UBE2L6 contributes to the targeted degradation of specific proteins, influencing cellular pathways and processes, particularly those related to cell cycle control and signaling cascades.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

O14933 (M1-S153)

Gene ID
Molecular Construction
N-term
UBE2L6 (M1-S153)
Accession # O14933
6*His
C-term
Synonyms
Ubiquitin/ISG15-Conjugating Enzyme E2 L6; Retinoic Acid-Induced Gene B Protein; RIG-B; UbcH8; Ubiquitin Carrier Protein L6; Ubiquitin-Protein Ligase L6; UBE2L6; UBCH8
AA Sequence

MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS

Molecular Weight

Approximately 17.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 50 mM HEPES, 100 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
UBE2L6 Protein, Human (His)
Cat. No.:
HY-P71020
Quantity:
MCE Japan Authorized Agent: