UBE2R2 Protein, Human (His)

UBE2R2 Protein, a key element in the ubiquitin-proteasome system, operates as an E2 ubiquitin-conjugating enzyme. It accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to diverse protein substrates. In vitro, UBE2R2 displays versatile catalytic activity, facilitating both monoubiquitination and 'Lys-48'-linked polyubiquitination reactions. This implies its potential involvement in various cellular processes, including the targeted degradation of proteins, suggesting a role in the regulation of substrates like katenin. UBE2R2 Protein, Human (His) is the recombinant human-derived UBE2R2 protein, expressed by E. coli, with N-6*His labeled tag. The total length of UBE2R2 Protein, Human (His) is 238 a.a., with molecular weight of ~37.0 kDa.

UBE2R2, an integral component of the ubiquitin-proteasome system, functions as an E2 ubiquitin-conjugating enzyme by accepting ubiquitin from the E1 complex and catalyzing its covalent attachment to diverse protein substrates. In in vitro assays, UBE2R2 demonstrates versatile catalytic activity, facilitating both monoubiquitination and 'Lys-48'-linked polyubiquitination reactions. This suggests its potential involvement in various cellular processes, including the targeted degradation of proteins, which may encompass the regulation of katenin or other relevant substrates.

Human

E. coli

N-6*His

Q712K3 (M1-S238)

54926  [NCBI]

MAQQQMTSSQKALMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPIDYPYSPPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMFRKWRDSKGKDKEYAEIIRKQVSATKAEAEKDGVKVPTTLAEYCIKTKVPSNDNSSDLLYDDLYDDDIDDEDEEEEDADCYDDDDSGNEES

Approximately 37.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.