1. Recombinant Proteins
  2. Ubiquitin Related Proteins
  3. Ubiquitin Enzymes
  4. E2 Enzymes
  5. Ubiquitin-Conjugating Enzyme E2 T
  6. UBE2T Protein, Human (His)

UBE2T protein is an important ubiquitination component. As an E2 ubiquitin-conjugating enzyme, it accepts ubiquitin in the E1 complex and catalyzes its covalent attachment to proteins. This multifaceted enzyme catalyzes monoubiquitination, which is critical during MMC-induced DNA repair. UBE2T Protein, Human (His) is the recombinant human-derived UBE2T protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

UBE2T protein is an important ubiquitination component. As an E2 ubiquitin-conjugating enzyme, it accepts ubiquitin in the E1 complex and catalyzes its covalent attachment to proteins. This multifaceted enzyme catalyzes monoubiquitination, which is critical during MMC-induced DNA repair. UBE2T Protein, Human (His) is the recombinant human-derived UBE2T protein, expressed by E. coli , with N-6*His labeled tag.

Background

UBE2T, an essential component of the ubiquitination machinery, serves as an E2 ubiquitin-conjugating enzyme that accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. This multifaceted enzyme demonstrates the ability to catalyze monoubiquitination, playing a crucial role in mitomycin-C (MMC)-induced DNA repair processes. UBE2T's significance is underscored by its specific association with the Fanconi anemia complex, where it collaborates with the E3 ubiquitin-protein ligase FANCL to catalyze monoubiquitination of FANCD2—an integral step in the DNA damage response pathway. Beyond its role in DNA repair, UBE2T exhibits versatility by mediating monoubiquitination of FANCL and FANCI and potentially contributing to the ubiquitination and degradation of BRCA1. Moreover, in vitro studies reveal UBE2T's capacity to promote various types of polyubiquitination, showcasing its involvement in diverse ubiquitin-dependent processes.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q9NPD8 (M1-V197)

Gene ID
Molecular Construction
N-term
6*His
UBE2T (M1-V197)
Accession # Q9NPD8
C-term
Synonyms
Ubiquitin-Conjugating Enzyme E2 T; Cell Proliferation-Inducing Gene 50 Protein; Ubiquitin Carrier Protein T; Ubiquitin-Protein Ligase T; UBE2T
AA Sequence

MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV

Molecular Weight

25-30 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of 50 mM HEPES, 150mM NaCl, 2 mM DTT, 10% Glycerol, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
UBE2T Protein, Human (His)
Cat. No.:
HY-P71409
Quantity:
MCE Japan Authorized Agent: