1. Recombinant Proteins
  2. Ubiquitin Related Proteins
  3. Deubiquitinase
  4. UCH Proteins
  5. UCH-L3
  6. UCHL3 Protein, Human (His)

UCHL3 Protein, a ubiquitin carboxyl-terminal hydrolase, is responsible for protein degradation and regulation of cellular processes. It is prominently expressed in the testes and plays a crucial role in spermatogenesis. UCHL3 Protein's involvement in male fertility and its potential as a therapeutic target in reproductive disorders make it a subject of interest in reproductive medicine. UCHL3 Protein, Human (His) is the recombinant human-derived UCHL3 protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

UCHL3 Protein, a ubiquitin carboxyl-terminal hydrolase, is responsible for protein degradation and regulation of cellular processes. It is prominently expressed in the testes and plays a crucial role in spermatogenesis. UCHL3 Protein's involvement in male fertility and its potential as a therapeutic target in reproductive disorders make it a subject of interest in reproductive medicine. UCHL3 Protein, Human (His) is the recombinant human-derived UCHL3 protein, expressed by E. coli , with C-6*His labeled tag.

Background

UCHL3 protein, a deubiquitinating enzyme (DUB), plays a crucial role in controlling cellular ubiquitin levels by processing ubiquitin precursors and hydrolyzing ubiquitinated proteins. As a thiol protease, UCHL3 exhibits a 10-fold preference for Arg and Lys at position P3'', with a particular affinity for 'Lys-48'-linked ubiquitin chains. In apical compartments, UCHL3 deubiquitinates ENAC, influencing apical membrane recycling. Additionally, it indirectly enhances the phosphorylation of IGFIR, AKT, and FOXO1, promoting insulin signaling and insulin-induced adipogenesis. UCHL3's involvement extends to stress-response in retinal, skeletal muscle, and germ cells, contributing to their maintenance. Notably, it can hydrolyze UBB(+1), a mutated form of ubiquitin associated with neurodegenerative disorders, which is not effectively degraded by the proteasome. This multifaceted enzyme may also play a role in working memory.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

P15374 (M1-A230)

Gene ID
Molecular Construction
N-term
UCHL3 (M1-A230)
Accession # P15374
6*His
C-term
Synonyms
Ubiquitin Carboxyl-Terminal Hydrolase Isozyme L3; UCH-L3; Ubiquitin Thioesterase L3; UCHL3
AA Sequence

MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLKKFLEESVSMSPEERARYLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA

Molecular Weight

Approximately 25.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 50 mM Tris-HCl, 150 mM NaCl, 1 mM DTT, 50% Glycerol, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

UCHL3 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
UCHL3 Protein, Human (His)
Cat. No.:
HY-P71115
Quantity:
MCE Japan Authorized Agent: