UGRP1 Protein, Human

UGRP1, a secreted cytokine-like protein, interacts with pathogens (L.monocytogenes, P.aeruginosa, yeast) and binds to MARCO. It strongly inhibits PLA2G1B activity, exerting anti-inflammatory and anti-fibrotic effects in the lung. UGRP1 may contribute to fetal lung development, inhibits FSH and LH production in the pituitary, and interacts with APOA1. Structurally, UGRP1 exists as a homodimer, with diverse physiological roles. UGRP1 Protein, Human is the recombinant human-derived UGRP1 protein, expressed by E. coli , with tag free. The total length of UGRP1 Protein, Human is 72 a.a., with molecular weight of ~6 & 7 kDa, respectively.

UGRP1 is a secreted cytokine-like protein with a broad range of functions. It binds to the scavenger receptor MARCO and exhibits binding capabilities to various pathogens, including the Gram-positive bacterium L.monocytogenes, the Gram-negative bacterium P.aeruginosa, and yeast. Additionally, UGRP1 strongly inhibits phospholipase A2 (PLA2G1B) activity and appears to exert anti-inflammatory effects in respiratory epithelium. Moreover, it demonstrates anti-fibrotic activity in the lung and may play a role in fetal lung development and maturation, actively promoting branching morphogenesis during the early stages of lung development. In the pituitary, UGRP1 is suggested to potentially inhibit the production of follicle-stimulating hormone (FSH) and luteinizing hormone (LH). Structurally, UGRP1 exists as a homodimer, held together by disulfide bonds, and can also function as a monomer. Furthermore, it interacts with APOA1, adding another layer to its involvement in diverse physiological processes.

Human

E. coli

Tag Free

Q96PL1 ( F22-V93)

117156  [NCBI]

FLINKVPLPVDKLAPLPLDNILPFMDPLKLLLKTLGISVEHLVEGLRKCVNELGPEASEAVKKLLEALSHLV

Approximately 6&7 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.