1. Recombinant Proteins
  2. Others
  3. UGRP1 Protein, Human

UGRP1, a secreted cytokine-like protein, interacts with pathogens (L.monocytogenes, P.aeruginosa, yeast) and binds to MARCO. It strongly inhibits PLA2G1B activity, exerting anti-inflammatory and anti-fibrotic effects in the lung. UGRP1 may contribute to fetal lung development, inhibits FSH and LH production in the pituitary, and interacts with APOA1. Structurally, UGRP1 exists as a homodimer, with diverse physiological roles. UGRP1 Protein, Human is the recombinant human-derived UGRP1 protein, expressed by E. coli , with tag free. The total length of UGRP1 Protein, Human is 72 a.a., with molecular weight of ~6 & 7 kDa, respectively.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

UGRP1, a secreted cytokine-like protein, interacts with pathogens (L.monocytogenes, P.aeruginosa, yeast) and binds to MARCO. It strongly inhibits PLA2G1B activity, exerting anti-inflammatory and anti-fibrotic effects in the lung. UGRP1 may contribute to fetal lung development, inhibits FSH and LH production in the pituitary, and interacts with APOA1. Structurally, UGRP1 exists as a homodimer, with diverse physiological roles. UGRP1 Protein, Human is the recombinant human-derived UGRP1 protein, expressed by E. coli , with tag free. The total length of UGRP1 Protein, Human is 72 a.a., with molecular weight of ~6 & 7 kDa, respectively.

Background

UGRP1 is a secreted cytokine-like protein with a broad range of functions. It binds to the scavenger receptor MARCO and exhibits binding capabilities to various pathogens, including the Gram-positive bacterium L.monocytogenes, the Gram-negative bacterium P.aeruginosa, and yeast. Additionally, UGRP1 strongly inhibits phospholipase A2 (PLA2G1B) activity and appears to exert anti-inflammatory effects in respiratory epithelium. Moreover, it demonstrates anti-fibrotic activity in the lung and may play a role in fetal lung development and maturation, actively promoting branching morphogenesis during the early stages of lung development. In the pituitary, UGRP1 is suggested to potentially inhibit the production of follicle-stimulating hormone (FSH) and luteinizing hormone (LH). Structurally, UGRP1 exists as a homodimer, held together by disulfide bonds, and can also function as a monomer. Furthermore, it interacts with APOA1, adding another layer to its involvement in diverse physiological processes.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q96PL1 ( F22-V93)

Gene ID
Molecular Construction
N-term
UGRP1 ( F22-V93)
Accession # Q96PL1
C-term
Synonyms
Secretoglobin Family 3A Member 2; Pneumo Secretory Protein 1; PnSP-1; Uteroglobin-Related Protein 1; SCGB3A2; PNSP1; UGRP1
AA Sequence

FLINKVPLPVDKLAPLPLDNILPFMDPLKLLLKTLGISVEHLVEGLRKCVNELGPEASEAVKKLLEALSHLV

Molecular Weight

Approximately 6&7 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

UGRP1 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
UGRP1 Protein, Human
Cat. No.:
HY-P71414
Quantity:
MCE Japan Authorized Agent: