ULBP4/RAET1E Protein, Human (HEK293, His)

ULBP4/RAET1E Protein crucially activates natural killer cell cytotoxicity by binding to and activating the KLRK1/NKG2D receptor. This interaction mediates cytotoxic responses, contributing to receptor activation and facilitating the recognition and targeting of marked cells for elimination. ULBP4/RAET1E's engagement with KLRK1/NKG2D underscores its significance in immune response regulation and natural killer cell activity modulation. ULBP4/RAET1E Protein, Human (HEK293, His) is the recombinant human-derived ULBP4/RAET1E protein, expressed by HEK293 , with C-His labeled tag. The total length of ULBP4/RAET1E Protein, Human (HEK293, His) is 195 a.a., with molecular weight of ~35-40 kDa.

The ULBP4/RAET1E protein plays a crucial role in natural killer cell cytotoxicity by serving as a ligand that binds to and activates the KLRK1/NKG2D receptor. This interaction between ULBP4/RAET1E and KLRK1/NKG2D is pivotal in mediating the cytotoxic responses of natural killer cells. Through its binding affinity with KLRK1/NKG2D, ULBP4/RAET1E contributes to the activation of this receptor, facilitating the recognition and targeting of cells marked for elimination. The engagement of ULBP4/RAET1E with KLRK1/NKG2D underscores its significance in the regulation of immune responses and the modulation of natural killer cell activity.

Human

HEK293

C-His

Q8TD07-1 (H31-D225)

135250  [NCBI]

HSLCFNFTIKSLSRPGQPWCEAQVFLNKNLFLQYNSDNNMVKPLGLLGKKVYATSTWGELTQTLGEVGRDLRMLLCDIKPQIKTSDPSTLQVEMFCQREAERCTGASWQFATNGEKSLLFDAMNMTWTVINHEASKIKETWKKDRGLEKYFRKLSKGDCDHWLREFLGHWEAMPEPTVSPVNASDIHWSSSSLPD

Approximately 35-40 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.