1. Recombinant Proteins
  2. Biotinylated Proteins Others
  3. ULBP1 Protein, Human (Biotinylated, HEK293, mFc-Avi)

ULBP1 Protein, Human (Biotinylated, HEK293, mFc-Avi)

Cat. No.: HY-P700458
Handling Instructions Technical Support

ULBP1/RAET1I Protein is crucial in natural killer cell cytotoxicity, binding to and activating the KLRK1/NKG2D receptor. This mechanism underscores ULBP1/RAET1I's significance in mediating cytotoxic responses. Notably, ULBP1/RAET1I does not bind beta2-microglobulin, emphasizing its specificity and selectivity in engaging KLRK1/NKG2D. This distinct interaction profile highlights ULBP1/RAET1I's pivotal role in immune responses and its potential as a therapeutic target for modulating natural killer cell activity. ULBP1 Protein, Human (Biotinylated, HEK293, mFc-Avi) is the recombinant human-derived ULBP1 protein, expressed by HEK293, with C-Avi, C-mFc labeled tag. The total length of ULBP1 Protein, Human (Biotinylated, HEK293, mFc-Avi) is 191 a.a., with molecular weight of 51.3 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ULBP1/RAET1I Protein is crucial in natural killer cell cytotoxicity, binding to and activating the KLRK1/NKG2D receptor. This mechanism underscores ULBP1/RAET1I's significance in mediating cytotoxic responses. Notably, ULBP1/RAET1I does not bind beta2-microglobulin, emphasizing its specificity and selectivity in engaging KLRK1/NKG2D. This distinct interaction profile highlights ULBP1/RAET1I's pivotal role in immune responses and its potential as a therapeutic target for modulating natural killer cell activity. ULBP1 Protein, Human (Biotinylated, HEK293, mFc-Avi) is the recombinant human-derived ULBP1 protein, expressed by HEK293, with C-Avi, C-mFc labeled tag. The total length of ULBP1 Protein, Human (Biotinylated, HEK293, mFc-Avi) is 191 a.a., with molecular weight of 51.3 kDa.

Background

The ULBP1/RAET1I protein plays a crucial role in natural killer cell cytotoxicity by acting as a ligand that binds to and activates the KLRK1/NKG2D receptor. This binding and activation mechanism highlights the significance of ULBP1/RAET1I in mediating the cytotoxic responses of natural killer cells. Moreover, it is noteworthy that ULBP1/RAET1I does not exhibit binding to beta2-microglobulin. This characteristic interaction profile underscores the specificity and selectivity of ULBP1/RAET1I in its engagement with KLRK1/NKG2D, emphasizing its pivotal role in immune responses and its potential as a therapeutic target for modulating natural killer cell activity.

Species

Human

Source

HEK293

Tag

C-Avi;C-mFc

Accession

Q9BZM6 (G26-G216)

Gene ID
Molecular Construction
N-term
ULBP1 (G26-G216)
Accession # Q9BZM6
mFc-Avi
C-term
Synonyms
ULBP1; UL16 binding protein 1; NKG2D ligand 1; UL16-binding protein-like transcript 1; MULT1; A430108B07Rik;
AA Sequence

GWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPG

Molecular Weight

51.3 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

ULBP1 Protein, Human (Biotinylated, HEK293, mFc-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ULBP1 Protein, Human (Biotinylated, HEK293, mFc-Avi)
Cat. No.:
HY-P700458
Quantity:
MCE Japan Authorized Agent: