UPRT Protein, Human (His)

Uracil phosphoribosyltransferase homolog (UPRT) catalyzes the conversion of uracil and 5-phosphoribosyl-1-R-diphosphate to uridine monophosphate (UMP) which is an important part of nucleotide metabolism. UPRT localizes to the nucleus and cytoplasm, and is a potential target for rational design of drugs to treat parasitic infections and cancer. UPRT Protein, Human (His) is the recombinant human-derived UPRT protein, expressed by E. coli , with N-6*His labeled tag.

Uracil phosphoribosyltransferase homolog (UPRT) catalyzes the conversion of uracil and 5-phosphoribosyl-1-R-diphosphate to uridine monophosphate (UMP). This reaction is an important part of nucleotide metabolism, specifically the pyrimidine salvage pathway. UPRT expressed strongly in human blood leukocytes, liver, spleen and thymus and moderately in the prostate, heart, brain, lung and skeletal muscle. UPRT localizes to the nucleus and cytoplasm. UPRT is a potential target for rational design of drugs to treat parasitic infections and cancer^[1][2].

Human

E. coli

N-6*His

Q96BW1-1 (M1-D309)

139596  [NCBI]

MATELQCPDSMPCHNQQVNSASTPSPEQLRPGDLILDHAGGNRASRAKVILLTGYAHSSLPAELDSGACGGSSLNSEGNSGSGDSSSYDAPAGNSFLEDCELSRQIGAQLKLLPMNDQIRELQTIIRDKTASRGDFMFSADRLIRLVVEEGLNQLPYKECMVTTPTGYKYEGVKFEKGNCGVSIMRSGEAMEQGLRDCCRSIRIGKILIQSDEETQRAKVYYAKFPPDIYRRKVLLMYPILSTGNTVIEAVKVLIEHGVQPSVIILLSLFSTPHGAKSIIQEFPEITILTTEVHPVAPTHFGQKYFGTD

Approximately 40.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.