1. Recombinant Proteins
  2. Others
  3. vacA Protein, Helicobacter pylori (His)

The VacA protein takes center stage, demonstrating its unique ability to induce vacuole formation in eukaryotic cells, affecting cell morphology. This process involves the formation of vacuoles, highlighting the role of VacA as a key regulator of cell structure. vacA Protein, Helicobacter pylori (His) is the recombinant vacA protein, expressed by E. coli , with N-6*His labeled tag. The total length of vacA Protein, Helicobacter pylori (His) is 209 a.a., with molecular weight of 26.6 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The VacA protein takes center stage, demonstrating its unique ability to induce vacuole formation in eukaryotic cells, affecting cell morphology. This process involves the formation of vacuoles, highlighting the role of VacA as a key regulator of cell structure. vacA Protein, Helicobacter pylori (His) is the recombinant vacA protein, expressed by E. coli , with N-6*His labeled tag. The total length of vacA Protein, Helicobacter pylori (His) is 209 a.a., with molecular weight of 26.6 kDa.

Background

VacA protein takes center stage with its distinctive ability to induce vacuolation in eukaryotic cells, showcasing its potent impact on cellular morphology. This process, characterized by the formation of vacuoles within the cells, reflects VacA's role as a key modulator of cellular architecture. Beyond its influence on cell morphology, VacA is implicated in causing ulceration and gastric lesions, underscoring its significant role in the pathogenesis of gastric disorders. The dual effects of vacuolation induction and the promotion of gastric lesions position VacA as a critical virulence factor, shedding light on its role in the complex interplay between bacterial pathogens and host cells in the context of gastric pathology.

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Human vacA is immobilized at 2.5 µg/mL(100 µL/well) can bind Anti-vacA Antibody.The ED50 for this effect is 135.7 ng/mL.

  • Measured by its binding ability in a functional ELISA. When Recombinant Human vacA is immobilized at 2.5 µg/mL(100 µL/well) can bind Anti-vacA Antibody.The ED50 for this effect is 135.7 ng/mL.
Species

Others

Source

E. coli

Tag

N-6*His

Accession

P55981 (T37-N245)

Gene ID

/

Molecular Construction
N-term
6*His
vacA (T37-N245)
Accession # P55981
C-term
Synonyms
Vacuolating cytotoxin autotransporter;
AA Sequence

TTVIIPAIVGGIATGAAVGTVSGLLGWGLKQAEEANKTPDKPDKVWRIQAGKGFNEFPNKEYDLYRSLLSSKIDGGWDWGNAATHYWVKGGQWNKLEVDMKDAVGTYNLSGLRNFTGGDLDVNMQKATLRLGQFNGNSFTSYKDSADRTTRVDFNAKNILIDNFLEINNRVGSGAGRKASSTVLTLQASEGITSSKNAEISLYDGATLN

Molecular Weight

Approximately 25-26.6 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0 or PBS, pH 7.0, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

vacA Protein, Helicobacter pylori (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
vacA Protein, Helicobacter pylori (His)
Cat. No.:
HY-P701331
Quantity:
MCE Japan Authorized Agent: