VEGF-CC Protein, Human (116a.a, HEK293, His)

The VEGF-CC protein is a potent growth factor in angiogenesis and endothelial cell growth, stimulating cell proliferation and migration while affecting vascular permeability. It plays a critical role in embryonic vein and lymphangiogenesis and maintains adult differentiated lymphatic endothelium. VEGF-C Protein, Human (116a.a, HEK293, His) is the recombinant human-derived VEGF-C protein, expressed by HEK293 , with C-6*His labeled tag. The total length of VEGF-C Protein, Human (116a.a, HEK293, His) is 116 a.a., with molecular weight of ~19.42 kDa.

The VEGF-CC Protein is a growth factor with significant activity in angiogenesis and endothelial cell growth, effectively stimulating their proliferation and migration while also influencing the permeability of blood vessels. This multifaceted protein is implicated in angiogenesis within both the venous and lymphatic vascular systems during embryogenesis and contributes to the maintenance of differentiated lymphatic endothelium in adults. VEGF-CC achieves these functions by binding and activating receptors KDR/VEGFR2 and FLT4/VEGFR3. Structurally, VEGF-CC exists as a homodimer, displaying a non-covalent and antiparallel arrangement. The protein's interaction with FLT4/VEGFR3 is crucial, as it is required for FLT4/VEGFR3 homodimerization and subsequent activation. These features collectively underscore the diverse roles of VEGF-CC in regulating vascular processes and highlight its significance in both developmental and adult angiogenesis.

Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED₅₀ for this effect is 5.559 ng /mL, corresponding to a specific activity is 1.80×10⁵ U/mg.

Human

HEK293

C-6*His

P49767 (A112-R227)

7424  [NCBI]

AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR

Approximately 19.42 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.